KEGG   Propionibacterium freudenreichii: PFREUD_03250Help
Entry
PFREUD_03250      CDS       T01252                                 

Gene name
rbsK
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PFREUD_03250 (rbsK)
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PFREUD_03250 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
401947..402939
Genome map
AA seq 330 aa AA seqDB search
MSDPSSSAPEVRAAARAARSALERVTNRRGRVGVLGSLNADLTVTTRTLPGPGETVVGDP
LVVRPGGKSANQAVACALAGADTLMVGAVGDDAHGEMLRESLTRAGVDISGVRSAQVATG
TAVITVDHRGENTIVVSAGANGTLGADDVHDAADALRAVSVLGLCLEVSDPALLAAQRLV
NSAGGTTVLNVSPLREVSAELVADAQVLIVNEHELAAVVGSDPGREPADIAAALDGHGIG
RAVVTLGAQGSVAVEAGLVVSVPAFPVQAIDTTGAGDAFMGTLMAAIAAEVPLGEGAALA
SAFAAVAVTRRGAQASYPGQPELQEFLARW
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccatcatcgtcggcgcccgaggtgcgggctgcggccagggctgcccgcagt
gcgctggaacgggtcaccaaccgtcggggacgagtgggggtgctcggctcgctgaacgcg
gacctcaccgtcaccacgcgcacgcttcccggccccggcgagaccgtcgtgggcgatccg
ctggtggtgcgtccgggcggcaagtcggccaaccaggcggtcgcctgcgcgctcgccggc
gccgacaccctcatggtcggggccgtcggcgacgacgcccatggcgagatgttgcgggag
tcgctgacccgggccggggtcgacatcagcggcgtgcggagcgcgcaggtggccaccggc
acggccgtgatcaccgtggaccaccggggcgagaacacgatcgtggtgtcagccggggcg
aacggcacgctgggggccgacgacgtgcacgacgccgccgacgccctgcgcgcggtcagc
gtgctgggactgtgcctggaagtgtctgacccggcgctgttggccgcgcagaggctggtg
aactcggcgggcggcaccaccgtgctcaatgtgtcaccgctgcgcgaggtgagcgccgaa
ctcgtcgcggacgcccaggtgctcatcgtcaacgaacacgagctcgcggcggtggtcggc
tccgatccgggccgggagccggccgatatcgcggcagcgctggacggccatggcatcggc
cgggccgtcgtcacgctgggggcgcagggttcggtggccgtggaggccggactggtggtg
agcgtgcctgccttccccgtgcaggccatcgacaccaccggtgccggtgacgccttcatg
ggcaccctcatggcggcgatcgccgccgaggtgccgctgggtgagggcgcggccctggcg
tcggcgttcgcggccgtggccgtcacccgacgcggtgcccaggcctcctacccgggccag
ccggagctgcaggagttcctggcccgctggtga

DBGET integrated database retrieval system