KEGG   Propionibacterium freudenreichii: PFREUD_03840Help
Entry
PFREUD_03840      CDS       T01252                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
pfr  Propionibacterium freudenreichii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PFREUD_03840 (recR)
DNA repair and recombination proteins [BR:pfr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PFREUD_03840 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466059..466685
Genome map
AA seq 208 aa AA seqDB search
MYDGPIQDLIDELGRLPGVGPKSAQRIAFWLLDQPQADVEQLANTLRTVKEGTHLCSICF
NVTDSDICRICRDPRRDHSSICVVEESKDVMAIERTREFRGLYHVLGGSISPIDGRGPGD
LRIAELVRRLQDPKVSEIILATDPNLEGDATATYISRLLGETPGIRVSRLASGLPVGGDL
EYADEVTLGRAFSGRRYVNDEEPADQSA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgacggacctatccaggatctgatcgacgagcttggcaggctgccgggcgtgggc
cccaagagcgcccagcgcatcgccttctggctgctcgaccagccccaggccgatgtggag
cagctggccaatacgctgcgcacggtgaaggagggcacccacctgtgctcgatctgcttc
aacgtgaccgactccgacatctgccgcatctgccgcgacccgcgtcgcgaccacagctcc
atctgcgtggtcgaggagtccaaggacgtgatggccattgagcgcacccgcgaattccgc
gggctctaccacgtgctcggtggctcgatcagcccgatcgacggccgtggccccggcgac
ctgcgcatcgccgaacttgtgcgacgcctgcaggacccgaaggtctccgagatcatcctg
gccaccgaccccaaccttgagggcgatgccaccgccacctatatctcgcggctgcttggt
gagacgcccggaatccgcgtgagccggctggcctccgggctgcccgtgggtggagacctc
gaatacgccgatgaggtgacgttgggccgcgccttcagtggccgtcgctatgtcaacgac
gaggaaccggccgaccagagcgcctga

DBGET integrated database retrieval system