KEGG   Propionibacterium freudenreichii: PFREUD_06950Help
Entry
PFREUD_06950      CDS       T01252                                 

Gene name
caiD
Definition
enoyl-CoA hydratase/carnithine racemase (EC:4.2.1.-)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pfr01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pfr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pfr00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pfr00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pfr00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pfr00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:pfr00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pfr00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pfr00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:pfr00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:pfr00362]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pfr00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(798488..799420)
Genome map
AA seq 310 aa AA seqDB search
MADGDVQFEVREGTGYLRLMRPTALNALSPQMIAVITEQLSAWRDDASVQALDISGEGRA
YCAGADVRWMRSTMIENGVQSALEFLADEYAMDAVVAQFGKPVTTHLHGVAMGGGLGLGM
HGATRVATADLAMAMPEVGIGLWPDVGMLFEFSRLPGEIGTWLALTGLTIDANTALAAGL
VDQVDLMSAKPDLDLTWVDDYFVGDDAREIITRLEASSDERAVQAGELIRTRSPLSVAVS
LAAIRRAATLHSVGDVLDQDLAIARALLPDPQCDFVEGVRAQLVDKDRQPHWSVARIEDI
DPDKARAIVG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccgatggtgatgtgcagttcgaggtgcgtgagggcaccggctacctgcggctgatg
cgccccacggcgctcaatgccctgtcgccccagatgatcgccgtgatcaccgaacagctg
agcgcctggcgcgacgatgcgtccgtgcaggccctggacatcagcggcgagggccgtgcc
tattgcgcgggcgccgatgtgcgctggatgcgctccacgatgatcgagaacggcgtgcag
tccgcactggagttcctggccgacgagtacgcgatggacgccgtcgtggcccagttcggc
aagcccgtcaccacccacctgcacggcgtggcgatggggggcggactgggattgggcatg
cacggggccacccgcgtggccaccgccgacctggcgatggcgatgcccgaggtgggcatt
gggctgtggcccgacgtcggaatgctgttcgagttctcgcgactgccgggcgagatcggc
acgtggctggccctgaccgggctcacgatcgatgcgaacacggcgctggcagcgggcctg
gtcgaccaggttgacctgatgtccgccaagcctgacctggacctgacatgggtggacgac
tacttcgtgggcgacgacgcccgcgagatcatcacccgcctggaggccagtagcgatgaa
cgtgccgtgcaggccggcgagctgatccgcacgcgttcccccctgtcggtcgccgtgtcg
ctggccgcgatccgtcgcgcagccacgctccacagcgtcggtgatgtgctcgaccaggac
ctcgccattgcccgggcgctgctccccgacccgcaatgcgacttcgtggagggcgtgcgg
gcccagctggtggacaaggaccgccagccccattggtcggtggcgcgcatcgaagacatt
gatcccgacaaggcccgcgccatcgtcggctga

DBGET integrated database retrieval system