KEGG   Propionibacterium freudenreichii: PFREUD_06950Help
Entry
PFREUD_06950      CDS       T01252                                 

Gene name
caiD
Definition
enoyl-CoA hydratase/carnithine racemase (EC:4.2.1.-)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PFREUD_06950 (caiD)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PFREUD_06950 (caiD)
   00650 Butanoate metabolism
    PFREUD_06950 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    PFREUD_06950 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFREUD_06950 (caiD)
   00310 Lysine degradation
    PFREUD_06950 (caiD)
   00360 Phenylalanine metabolism
    PFREUD_06950 (caiD)
   00380 Tryptophan metabolism
    PFREUD_06950 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFREUD_06950 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PFREUD_06950 (caiD)
   00281 Geraniol degradation
    PFREUD_06950 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFREUD_06950 (caiD)
   00627 Aminobenzoate degradation
    PFREUD_06950 (caiD)
   00930 Caprolactam degradation
    PFREUD_06950 (caiD)
Enzymes [BR:pfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PFREUD_06950 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(798488..799420)
Genome map
AA seq 310 aa AA seqDB search
MADGDVQFEVREGTGYLRLMRPTALNALSPQMIAVITEQLSAWRDDASVQALDISGEGRA
YCAGADVRWMRSTMIENGVQSALEFLADEYAMDAVVAQFGKPVTTHLHGVAMGGGLGLGM
HGATRVATADLAMAMPEVGIGLWPDVGMLFEFSRLPGEIGTWLALTGLTIDANTALAAGL
VDQVDLMSAKPDLDLTWVDDYFVGDDAREIITRLEASSDERAVQAGELIRTRSPLSVAVS
LAAIRRAATLHSVGDVLDQDLAIARALLPDPQCDFVEGVRAQLVDKDRQPHWSVARIEDI
DPDKARAIVG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccgatggtgatgtgcagttcgaggtgcgtgagggcaccggctacctgcggctgatg
cgccccacggcgctcaatgccctgtcgccccagatgatcgccgtgatcaccgaacagctg
agcgcctggcgcgacgatgcgtccgtgcaggccctggacatcagcggcgagggccgtgcc
tattgcgcgggcgccgatgtgcgctggatgcgctccacgatgatcgagaacggcgtgcag
tccgcactggagttcctggccgacgagtacgcgatggacgccgtcgtggcccagttcggc
aagcccgtcaccacccacctgcacggcgtggcgatggggggcggactgggattgggcatg
cacggggccacccgcgtggccaccgccgacctggcgatggcgatgcccgaggtgggcatt
gggctgtggcccgacgtcggaatgctgttcgagttctcgcgactgccgggcgagatcggc
acgtggctggccctgaccgggctcacgatcgatgcgaacacggcgctggcagcgggcctg
gtcgaccaggttgacctgatgtccgccaagcctgacctggacctgacatgggtggacgac
tacttcgtgggcgacgacgcccgcgagatcatcacccgcctggaggccagtagcgatgaa
cgtgccgtgcaggccggcgagctgatccgcacgcgttcccccctgtcggtcgccgtgtcg
ctggccgcgatccgtcgcgcagccacgctccacagcgtcggtgatgtgctcgaccaggac
ctcgccattgcccgggcgctgctccccgacccgcaatgcgacttcgtggagggcgtgcgg
gcccagctggtggacaaggaccgccagccccattggtcggtggcgcgcatcgaagacatt
gatcccgacaaggcccgcgccatcgtcggctga

DBGET integrated database retrieval system