KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_08280Help
Entry
PFREUD_08280      CDS       T01252                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase (O-phospho-L-homoserine phosphate-lyase (adding water;L-threonine-forming))
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00260  Glycine, serine and threonine metabolism
pfr00750  Vitamin B6 metabolism
pfr01100  Metabolic pathways
pfr01110  Biosynthesis of secondary metabolites
pfr01120  Microbial metabolism in diverse environments
pfr01230  Biosynthesis of amino acids
Module
pfr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFREUD_08280 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PFREUD_08280 (thrC)
Enzymes [BR:pfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PFREUD_08280 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CBL56355
UniProt: D7GCU4
Position
942911..944353
Genome map
AA seq 480 aa AA seqDB search
MRYVSTRAASADASEPFSDILLEGLAPDGGLYLPVTYPRVDAQTLTRWRAVLAEQGYAAL
AAEVIGLYIDDIGHDDLLELCRRAYTAEKFGDPQIVPVTRIGDEPLWLGHLSNGPTAAFK
DMAMQLLGEFFEYELRRRSSWLTIVGATSGDTGSSAEYAMRGRDGLSVVMLTPAGRMTPF
QQAQMFGLQDPNIINVAVDGVFDTCQDLVKALNADAEFKHRWHVGAVNSINWARLVAQVV
YYFACWLRVTTSADEQISFAVPTGNFGNVCAGHIARSMGLPIKRLIVATNENDVLDEFFH
TGRYRVRGAVETVATSSPSMDISKASNFERFIADLFGRDGATVRRLFDQLARTGEFDISG
TAQFTAVIQQYGFVSGHSSHADRLATIKRLWTTDQILIDPHTADGVHVAEQFAGDEQIVV
LETALPVKFADTIKEATGELPPVPPRFAHIGEGPRRVIEMGDDLGALKKLVADTVGTLRA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctatgtgtcaacccgtgccgcgtccgccgatgcctcggagcccttctccgatatc
ctgctggaaggcctcgcccccgacgggggcctctacctgcccgtcacctacccccgggtc
gatgcacagaccctcacccggtggcgcgccgtgctggccgagcagggctatgcggcgctg
gctgccgaggtgatcggcctctatatcgatgacatcggccatgatgacctgctggaactg
tgtcgcagggcctacaccgccgagaagttcggcgacccccagatcgtgccggtgacgcgc
atcggcgacgaacccctgtggctggggcacctgtccaatggaccgacggcggccttcaag
gacatggcgatgcagttgctcggggagttcttcgagtacgagctgcgtcgccggtccagc
tggctgaccatcgttggcgccaccagcggcgataccggaagctcggccgagtatgcgatg
cgcggacgtgacgggctgagcgtcgtgatgctgaccccggcgggcaggatgacccccttc
cagcaggcccagatgttcggcctgcaggatcccaacatcatcaatgtcgcggtcgacggc
gtcttcgacacctgtcaggacctggtgaaggccctcaacgccgacgccgagttcaagcat
cgctggcacgtcggtgccgtcaactcgatcaactgggcccgcctggtggcccaggtggtc
tactacttcgcctgctggctgcgcgtcaccaccagcgccgacgaacagatcagcttcgcg
gtgcccaccgggaacttcggcaatgtctgcgccgggcacatcgcccgctccatgggattg
ccgatcaagcgcctcatcgtggccactaatgagaacgacgtgctcgacgagttcttccac
accggccgataccgggtgcgcggcgccgtcgagaccgtggccacctcaagcccctccatg
gacatttcgaaggcctcgaacttcgagcgcttcatcgccgacctgttcggacgggacggt
gcgaccgtgcgcaggctgttcgaccagctcgcccgcaccggggagttcgacatctcgggg
acggcgcagttcacggccgtcatccagcagtacggcttcgtctcgggccattccagccat
gcagaccgcctggccaccatcaagcgcctgtggaccaccgaccagatcctcatcgacccg
cacaccgccgacggcgtccatgtcgccgagcagttcgccggcgacgagcagatcgtggtg
ctggagaccgcacttccggtcaagttcgccgacaccatcaaggaggccaccggggagttg
ccacccgtgccgccgcgcttcgcccacatcggggaggggccgcgtcgggtcatcgagatg
ggcgacgacctgggcgccctcaagaagctcgtggccgacaccgtgggcaccctgcgggcc
tag

DBGET integrated database retrieval system