KEGG   Propionibacterium freudenreichii: PFREUD_08290Help
Entry
PFREUD_08290      CDS       T01252                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFREUD_08290 (pfkA)
   01230 Biosynthesis of amino acids
    PFREUD_08290 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFREUD_08290 (pfkA)
   00030 Pentose phosphate pathway
    PFREUD_08290 (pfkA)
   00051 Fructose and mannose metabolism
    PFREUD_08290 (pfkA)
   00052 Galactose metabolism
    PFREUD_08290 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PFREUD_08290 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PFREUD_08290 (pfkA)
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PFREUD_08290 (pfkA)
Protein phosphatases and associated proteins [BR:pfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PFREUD_08290 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944432..945553
Genome map
AA seq 373 aa AA seqDB search
MSMRVGILTSGGDSPGLNAAIRGFGKAAVSTYGMELIGFRDGMRGLAENRFMQLDSHALS
GILTTGGTILGTSRDKVHKMLVDGKVQNMIPVIKKNYEKNKLDALVCLGGGGTAKNAKRL
SDAGMNVITLPKTIDNDLVGTDQTFGFATALEIATDAVDRLHSTAHSHHRIILTEIMGHR
AGWLALGAGIAGGADVILLPEVPYNVESIAAAISRRSAHGSNFSVVAVAEGARNERDAAE
LAAADALVREADSPVARDAAKTHRANVEASHRAHTFTLATELEKATGLESRVTILGYVQR
GGTPCGRDRVLATVLGTAGADLVAKGVFGVMVAAKGDGAEPVPLEEVAGKIRRVPVDHPW
IRAAKEVGTGFGD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcgcgtcggaattctcacctccggtggagacagccccggcctcaacgccgcc
atccgtggattcggcaaggccgccgtgagcacctacggcatggaactgatcggcttccgc
gacgggatgcggggcctggcggagaaccgcttcatgcagctcgactcgcacgcactgtcc
ggcatcctcaccaccggcggcaccatcctgggcaccagtcgcgacaaggtgcacaagatg
ctggtcgacggcaaggtgcagaacatgatccccgtgatcaagaagaactacgagaagaac
aagctggacgccctggtctgcctgggtggcggcggcaccgccaagaacgccaagcgcctg
tccgacgccggcatgaacgtgatcacgctgcccaagacgattgacaatgacctggtgggc
accgaccagaccttcgggttcgccacggccctggagattgccactgatgcggtcgaccgc
ctccattccaccgcacacagccaccatcgcatcatcctcaccgagatcatggggcaccgt
gccggatggctggcattgggtgcggggatcgccggtggcgccgatgtgatcctgctgccc
gaggtgccctacaacgtcgagtccatcgccgcggccatcagccgccgctccgcccatggc
tcgaacttctcggtggtggccgtggccgagggcgcgcgcaatgagcgtgacgccgccgaa
ctcgccgccgccgacgcactggtgcgcgaggccgattcaccggtggcccgcgacgccgcg
aagacccaccgggccaatgtcgaggcctcgcatcgggcccataccttcacgctggccacc
gagctggagaaggccaccggactcgaatcgcgcgtgaccatcctgggctacgtccagcgc
ggcggcacgccgtgtggacgcgaccgcgtgctggccaccgtgctcggcactgccggcgcc
gacctggtcgccaagggcgtcttcggtgtcatggtcgccgcgaagggcgacggggcagag
ccggttccgctcgaggaggtggccggcaagatccgccgcgtacccgtcgaccacccgtgg
atccgggcggccaaggaggtcggcaccgggttcggcgactga

DBGET integrated database retrieval system