KEGG   Propionibacterium freudenreichii: PFREUD_08290Help
Entry
PFREUD_08290      CDS       T01252                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pfr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pfr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pfr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pfr00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pfr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944432..945553
Genome map
AA seq 373 aa AA seqDB search
MSMRVGILTSGGDSPGLNAAIRGFGKAAVSTYGMELIGFRDGMRGLAENRFMQLDSHALS
GILTTGGTILGTSRDKVHKMLVDGKVQNMIPVIKKNYEKNKLDALVCLGGGGTAKNAKRL
SDAGMNVITLPKTIDNDLVGTDQTFGFATALEIATDAVDRLHSTAHSHHRIILTEIMGHR
AGWLALGAGIAGGADVILLPEVPYNVESIAAAISRRSAHGSNFSVVAVAEGARNERDAAE
LAAADALVREADSPVARDAAKTHRANVEASHRAHTFTLATELEKATGLESRVTILGYVQR
GGTPCGRDRVLATVLGTAGADLVAKGVFGVMVAAKGDGAEPVPLEEVAGKIRRVPVDHPW
IRAAKEVGTGFGD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcgcgtcggaattctcacctccggtggagacagccccggcctcaacgccgcc
atccgtggattcggcaaggccgccgtgagcacctacggcatggaactgatcggcttccgc
gacgggatgcggggcctggcggagaaccgcttcatgcagctcgactcgcacgcactgtcc
ggcatcctcaccaccggcggcaccatcctgggcaccagtcgcgacaaggtgcacaagatg
ctggtcgacggcaaggtgcagaacatgatccccgtgatcaagaagaactacgagaagaac
aagctggacgccctggtctgcctgggtggcggcggcaccgccaagaacgccaagcgcctg
tccgacgccggcatgaacgtgatcacgctgcccaagacgattgacaatgacctggtgggc
accgaccagaccttcgggttcgccacggccctggagattgccactgatgcggtcgaccgc
ctccattccaccgcacacagccaccatcgcatcatcctcaccgagatcatggggcaccgt
gccggatggctggcattgggtgcggggatcgccggtggcgccgatgtgatcctgctgccc
gaggtgccctacaacgtcgagtccatcgccgcggccatcagccgccgctccgcccatggc
tcgaacttctcggtggtggccgtggccgagggcgcgcgcaatgagcgtgacgccgccgaa
ctcgccgccgccgacgcactggtgcgcgaggccgattcaccggtggcccgcgacgccgcg
aagacccaccgggccaatgtcgaggcctcgcatcgggcccataccttcacgctggccacc
gagctggagaaggccaccggactcgaatcgcgcgtgaccatcctgggctacgtccagcgc
ggcggcacgccgtgtggacgcgaccgcgtgctggccaccgtgctcggcactgccggcgcc
gacctggtcgccaagggcgtcttcggtgtcatggtcgccgcgaagggcgacggggcagag
ccggttccgctcgaggaggtggccggcaagatccgccgcgtacccgtcgaccacccgtgg
atccgggcggccaaggaggtcggcaccgggttcggcgactga

DBGET integrated database retrieval system