KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_08290Help
Entry
PFREUD_08290      CDS       T01252                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00010  Glycolysis / Gluconeogenesis
pfr00030  Pentose phosphate pathway
pfr00051  Fructose and mannose metabolism
pfr00052  Galactose metabolism
pfr00680  Methane metabolism
pfr01100  Metabolic pathways
pfr01110  Biosynthesis of secondary metabolites
pfr01120  Microbial metabolism in diverse environments
pfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFREUD_08290 (pfkA)
   00030 Pentose phosphate pathway
    PFREUD_08290 (pfkA)
   00051 Fructose and mannose metabolism
    PFREUD_08290 (pfkA)
   00052 Galactose metabolism
    PFREUD_08290 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PFREUD_08290 (pfkA)
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PFREUD_08290 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PFREUD_08290 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF347
Motif
Other DBs
NCBI-ProteinID: CBL56356
UniProt: D7GCU5
Position
944432..945553
Genome map
AA seq 373 aa AA seqDB search
MSMRVGILTSGGDSPGLNAAIRGFGKAAVSTYGMELIGFRDGMRGLAENRFMQLDSHALS
GILTTGGTILGTSRDKVHKMLVDGKVQNMIPVIKKNYEKNKLDALVCLGGGGTAKNAKRL
SDAGMNVITLPKTIDNDLVGTDQTFGFATALEIATDAVDRLHSTAHSHHRIILTEIMGHR
AGWLALGAGIAGGADVILLPEVPYNVESIAAAISRRSAHGSNFSVVAVAEGARNERDAAE
LAAADALVREADSPVARDAAKTHRANVEASHRAHTFTLATELEKATGLESRVTILGYVQR
GGTPCGRDRVLATVLGTAGADLVAKGVFGVMVAAKGDGAEPVPLEEVAGKIRRVPVDHPW
IRAAKEVGTGFGD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcgcgtcggaattctcacctccggtggagacagccccggcctcaacgccgcc
atccgtggattcggcaaggccgccgtgagcacctacggcatggaactgatcggcttccgc
gacgggatgcggggcctggcggagaaccgcttcatgcagctcgactcgcacgcactgtcc
ggcatcctcaccaccggcggcaccatcctgggcaccagtcgcgacaaggtgcacaagatg
ctggtcgacggcaaggtgcagaacatgatccccgtgatcaagaagaactacgagaagaac
aagctggacgccctggtctgcctgggtggcggcggcaccgccaagaacgccaagcgcctg
tccgacgccggcatgaacgtgatcacgctgcccaagacgattgacaatgacctggtgggc
accgaccagaccttcgggttcgccacggccctggagattgccactgatgcggtcgaccgc
ctccattccaccgcacacagccaccatcgcatcatcctcaccgagatcatggggcaccgt
gccggatggctggcattgggtgcggggatcgccggtggcgccgatgtgatcctgctgccc
gaggtgccctacaacgtcgagtccatcgccgcggccatcagccgccgctccgcccatggc
tcgaacttctcggtggtggccgtggccgagggcgcgcgcaatgagcgtgacgccgccgaa
ctcgccgccgccgacgcactggtgcgcgaggccgattcaccggtggcccgcgacgccgcg
aagacccaccgggccaatgtcgaggcctcgcatcgggcccataccttcacgctggccacc
gagctggagaaggccaccggactcgaatcgcgcgtgaccatcctgggctacgtccagcgc
ggcggcacgccgtgtggacgcgaccgcgtgctggccaccgtgctcggcactgccggcgcc
gacctggtcgccaagggcgtcttcggtgtcatggtcgccgcgaagggcgacggggcagag
ccggttccgctcgaggaggtggccggcaagatccgccgcgtacccgtcgaccacccgtgg
atccgggcggccaaggaggtcggcaccgggttcggcgactga

DBGET integrated database retrieval system