KEGG   Propionibacterium freudenreichii: PFREUD_08490Help
Entry
PFREUD_08490      CDS       T01252                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFREUD_08490 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PFREUD_08490 (proB)
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PFREUD_08490 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
966779..967951
Genome map
AA seq 390 aa AA seqDB search
MMTDQVPSVVPALDTEESVRAAIGSARRIVVKIGSSSLSSARRGLDDARLAALVAALADV
HDAGRDIVLISSGAIAAGLKPLGLTRRPRDVAHQQAAAAVGQGLLIERYTEMFAHRDIRV
GQVLLTPDDVAVRDNYHNALRALGTLLRMGVLPVVNENDTVATQEIRFGDNDRLAALVAQ
LVRADALVILSDVDALYTSHPDDPGAQAISFVPDVDELRVDTHRIGSAVGTGGMNTKVQA
AQLAASAGIPVMLARANAVLDALHGAPVGTAFAPVDHARPRRLLWLAYASRVKGCLKLDA
GAVRALTNRKASLLAAGVTDVRGHFVAGDPVEVEGPEGDIVARGLVNYSSDELPSMLGKN
SADLGVEMGEGFDRAVVHRDMLVLMNHPGV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgaccaggttccctcggttgttcccgccctcgacacggaggagagcgtgcgc
gcggcgatcggatccgcacggcgcatcgtggtcaagatcggctcctcgtcgctgtcgagt
gcccggcgtggactcgacgatgcccggttggcagcactggtggccgcactggccgatgtg
cacgacgcgggacgcgacatcgtgctcatcagctcgggggcgatcgcggccggactgaag
ccattggggctcacccggcgtccccgcgacgtcgcccaccagcaggccgccgccgcagtg
ggccagggcctgctcattgagcgatacaccgagatgttcgcccatcgcgacatccgtgtg
ggccaggtgctgctgacgcccgacgatgtggcggtacgcgacaattaccacaacgccctg
cgcgccctgggcaccctgttgcgcatgggcgtgctgcccgtggtcaacgagaacgacacc
gtggccacccaggagatccgcttcggcgacaacgaccggttggccgccctggtggcgcaa
ctggtccgggccgacgccctggtgatcctgtccgatgtggacgccctgtacacctcccat
cccgacgatccgggcgcacaggccatctccttcgtgccggacgtcgacgaactgcgcgtg
gacacccaccgcatcggctctgcggtgggaacgggcggcatgaacaccaaggtgcaggcc
gcccagctggcggcctcggcgggcatcccggtgatgctggcgcgggccaacgccgtcctc
gacgccctgcacggcgccccggtgggcaccgccttcgcccccgtggaccatgcccgaccg
cgccgtctgctgtggctggcctatgcctcacgggtgaagggctgcctcaagttggacgcc
ggcgcggtgcgcgcgctgaccaaccgcaaggcatcgctgctggcggcaggtgttaccgac
gtgcgtggacatttcgtggccggcgatccggttgaggtcgagggtcccgagggcgatatc
gttgcccgcggactggtcaactattcaagcgacgagttgccgtccatgttgggcaagaat
tctgccgatctcggtgtggagatgggtgagggcttcgaccgagccgtggtgcaccgcgac
atgctggtgctgatgaaccacccgggggtctga

DBGET integrated database retrieval system