KEGG   Propionibacterium freudenreichii: PFREUD_09840Help
Entry
PFREUD_09840      CDS       T01252                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PFREUD_09840 (recD)
Enzymes [BR:pfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PFREUD_09840 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1108688..1110541)
Genome map
AA seq 617 aa AA seqDB search
MIPSDGRVVSATGVLAQFAAAGVLEAADVHVAKMVTRTGGENDPSVALAVALTVRALRAG
SVCLPLDQARPMAHFFVREDDDQAARTDIDALPWPDPLDWLATVVDSPLVGDEDATINSR
PLRCVDGAVYLERYWCDQESIRVILAHRAEPLPAVDESALTAALDEFFPGGDQEADQRRA
VAAAVRGRTTVIAGGPGTGKTRTISWVVEAMRRQWMAQGETGRIALAAPTGKAAARLTES
LRENTAGPSSPAGTQGAGEDAMAVPGQLHAVTLHRLLGARPGRGVSFGPARRLPYDLVVV
DEMSMVSLSLMARLLEALSPSTRLVMVGDADQLTPVDAGAVLADITAAGLAGPDPLGGGI
VELRHGFRFDSAIAQLADAVRRGDADATLELLRASPEGLQFDELDPGIVELDALPALRRE
LEVQARGIGHAATSGDGNGAVRALEGHRLLCAHRTGVYGVSRWSAMVQQVQRPALASGSD
ADPDWFTGRPLLATRNMAELGISNGDTGVVIATPEGPRAAMSNGRSYAPFVLEGIETMFA
MTIHKSQGSQFDRVTVVLPGADSPLLTRELLYTAITRARRGVRIIGLREAIVTAVRTPAR
RASGLTDRLQRTSVRPH
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtgattcccagtgatggccgcgtcgtgtcggccaccggcgttctcgcgcagttcgctgcc
gcgggagtgctggaggcagcggacgtgcatgtggccaagatggtgacgcgtaccggtggg
gagaacgatccgtccgtcgccctggcggtggccctgaccgtgcgggcgttgcgggccggt
tcggtgtgcctgccgctggaccaggcacgtccgatggcgcacttcttcgtccgtgaggac
gacgatcaggccgctcgcactgacattgacgccttgccgtggccggatccgctggattgg
ttggccaccgtggtggactcgcccctggtcggcgatgaggacgccacgatcaattcccgg
ccgctgcgctgcgtggacggtgcggtctacctggaacgctattggtgcgatcaggagtcg
atcagggtcatcctggcccaccgcgccgaaccgctgcccgccgttgatgagtccgccctg
accgcggcgctggatgagttcttccccggcggggaccaggaggccgaccaacgccgtgcc
gtggcagctgccgtgcggggacgcacgacggtgatcgccggcggcccgggcacgggcaag
acccggaccatttcctgggtggtcgaggccatgcgccgccagtggatggcccagggcgag
accgggcggatcgcgctcgccgcacccaccggcaaggccgctgcccgtctcaccgagtcg
ctccgggagaacacggccggcccctcctcccctgccgggacgcagggggcgggtgaggac
gcgatggcagtcccgggccaactccacgcggtgaccctgcatcggctcctgggagcacgt
ccgggacgcggcgtcagcttcggacccgctcgccggctcccctacgacctggtggtggtc
gatgagatgtcgatggtctcgttgagcctgatggcacgactgctggaggccctttccccc
tcgaccaggttggtgatggttggcgacgcggatcagttgacgcctgtcgatgccggcgcc
gtgctggccgacatcacggccgcggggctcgccggccccgatcctctcgggggcggcatc
gtggagctccggcacggatttcgcttcgattccgcgatcgcccagttggccgatgccgtg
cgtcgcggtgatgccgatgccacgctggaattgctccgggcctcgcccgagggcctgcag
ttcgacgagctcgacccgggcatcgtcgaactggatgcattgcccgcgctgcgccgcgaa
ctcgaggtgcaggcccggggcattggtcacgccgcgacatccggggatggcaacggcgcg
gtgcgggcgctcgagggccatcgcctgctgtgtgcccaccgtaccggcgtgtacggggtg
agccgctggtcggcaatggtccagcaggtgcagcgcccggcgctggcctccggctcggat
gccgatcctgactggttcaccggacggccgctgctggccacccggaacatggcggaactg
ggtatcagcaatggcgataccggggtggtgatcgcgacccccgaggggccgcgggcagcc
atgagcaatggacgcagctatgcaccgttcgtgctcgagggcatcgagacgatgttcgcc
atgacaatccacaagtcccagggcagccagttcgaccgggtcacggtcgtcctgcccggg
gccgactcgccgttgctcacccgtgagctcctgtacaccgccatcaccagggcccgccgg
ggagtgcggatcatcggattgcgcgaggccatcgtcacggcggttcggacgcccgcgcgc
cgtgcgtccgggttgaccgatcggctacaacgcacgagtgtccgaccccactga

DBGET integrated database retrieval system