KEGG   Propionibacterium freudenreichii: PFREUD_10900Help
Entry
PFREUD_10900      CDS       T01252                                 

Gene name
MurA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PFREUD_10900 (MurA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PFREUD_10900 (MurA)
Enzymes [BR:pfr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     PFREUD_10900 (MurA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1226919..1228454
Genome map
AA seq 511 aa AA seqDB search
MTQETTPARIGRLIRDARKQRGMTQNQLAEELSTSQSAIHRIESGHQNLSLETINRIAGA
LESPLIVPGNSSTLNFRIGGETHLSGSIETRSSKNAAVALLCACLLNQGRTVLKGIAHIE
EVNRLLEVLTSIGVDASWSPDGKDLTLQRPDTLDLENMDVAAARRTRSILMFMGPLSRFF
SEFRLPYAGGCDLGVRTVEPHMQSLRHFGVNVLATEGFYRASVTRTGPDTRHIVLTERGD
TVTENTLMAAAVSPGVSVIRNASSNYMVQDLCAFLMLLGVEIDGVGTTTLTVRGLSEAPS
MDVSYEISEDPIEAMSLITAAVVTKSELTITRVPIEFTEIELSILGEEMGLHYGLSSEYK
SGNGLTRLVDLTIYPSELKAPPDKIHPMPFPGLNIDNLPFFAVLAATAHGQTMIHDWVFE
NRAIHLLQLNQLGAHVQLLDPHRLIVQGPTRWRGREMVSPPALRPAVTIMLAMLAATGTS
VLHDVYVINRGYEDLPARLNALGADIETFYD
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaggaaactacgcccgccaggatcggccggctcatccgcgacgcgcgcaagcag
cgcggcatgacgcagaatcagctcgctgaagaactcagcaccagccagagcgcgatccac
aggatcgagtccgggcaccagaacctctccctcgagacgatcaaccggatcgccggggcg
ctcgagtctcccctcatcgtgccggggaactccagcaccctcaacttccggatcggtggc
gagacccacctgtcagggtccatcgagacccggtcgagcaagaacgccgcagtggccctg
ctgtgtgcctgcctgctcaaccaggggcgcacggtgctgaagggaatagcgcacatcgag
gaggtcaaccgcctgctggaggtgctcacgagcatcggagtggacgccagttggtcgcct
gacggcaaggacctcaccctgcagcgcccggacacccttgacctggagaacatggacgtc
gcagcagcgcgccggacgcgttcgatcctgatgttcatgggcccactcagtcggttcttc
tcagagttccgccttccttacgcaggcggctgcgacctgggcgtgcgcaccgtggaaccg
cacatgcagtcactgcgccacttcggggtcaacgtgctggccaccgagggcttctaccgc
gccagcgtcacccgcaccgggccggacacccggcacatcgtgctcaccgagcgtggtgac
acggtgacggagaacaccctgatggcggcggcggtctcgccgggcgtgagtgtcatccgc
aatgccagctccaactacatggtgcaggacctgtgcgccttcctgatgctgctcggggtg
gagatcgatggcgtgggtaccaccaccctcaccgtccggggcctgtcggaggcgcccagc
atggacgtgtcctatgagatcagtgaggacccgatcgaggccatgagcctgatcaccgcc
gccgtggtgaccaagtcggaactcaccatcacccgcgtgccgatcgagttcaccgagatc
gaactgtcgatcctcggcgaggagatgggcctgcactacgggctgagcagcgagtacaag
tcgggcaatggactcacccgcctggtcgacctgacgatctatcccagcgagttgaaggcc
ccgccggacaagatccacccgatgcccttccccggcctcaacatcgacaaccttcccttc
ttcgccgtgctggccgccacggcccacggccagaccatgatccatgactgggtgttcgag
aaccgggcgatccacctgctccagctcaaccagctcggggcccacgtgcagttgctcgac
ccgcaccgcctcatcgtgcagggcccgacccgctggcgcggacgcgagatggtctccccc
ccggcgctgcgccctgcggtcaccatcatgctggccatgctggccgccaccggaaccagc
gtgctgcacgacgtctacgtgatcaatcgcggatacgaggacctgccggccaggctcaac
gccctgggcgccgacatcgagaccttctacgactga

DBGET integrated database retrieval system