KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_11790Help
Entry
PFREUD_11790      CDS       T01252                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase (HDH)
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00340  Histidine metabolism
pfr01100  Metabolic pathways
pfr01110  Biosynthesis of secondary metabolites
pfr01230  Biosynthesis of amino acids
Module
pfr_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PFREUD_11790 (hisD)
Enzymes [BR:pfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PFREUD_11790 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CBL56701
UniProt: D7GDU0
Position
complement(1324658..1325971)
Genome map
AA seq 437 aa AA seqDB search
MLRMIDVTGQRLDDYTAVLPRGHFDVEHAVAAVEPICRAVAEEGETALRRFAEQFDHVVP
EQLRVPEEALDRALDDLEPGLRAAIEESIRRRREVARGIETEEAFREIEVAPGARVANRL
VPVGRVGLYVPGGLAPLASTVLMNVVPAQVAGVQSIAVATPPQAEFGGLPHPTILAVCRL
LGVTEVYAVGGAQAVAMFAYGVPGLCRRADMVTGPGNIYVVAAKRLLRGRIGIDAEAGPT
EILVLADDRANPAYVAADLISQAEHDPMAGAVLVTDSSALLTRVEEELADQVERLATRDR
LKVSLTGEQSGVVLVADMDQGIDVVNDYAPEHLEIQTVDAAALAQRVRSAGAVFVGSHSP
VPLGDYSAGSTHVLPTGGAAHFSSGLTTRSFLKAMHIIDYSAQALGAIGDAVEQFAHAEH
LPGHAEAIAVRTGREVE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgaatgattgatgtcaccggccaacgactcgacgactacaccgcggttctgccc
cgcggccacttcgacgtcgagcatgccgtggcagccgtcgaaccgatctgccgggccgtc
gccgaggagggcgagaccgcgctgcgtcgctttgccgagcaattcgaccatgtggtcccc
gagcagctccgcgtgcccgaggaagcgcttgaccgggccctggacgacctggagcccgga
ttgcgggcagccatcgaggagtccattcgccgccgtcgcgaggtggcccgggggatcgag
accgaggaggccttccgggagatcgaggtggcgccgggtgcccgcgtcgccaaccggctc
gtaccggtgggccgggtcgggctgtacgttcccggagggcttgcaccgctcgcctccacg
gtgttgatgaacgtggttcccgcccaggtggccggcgtgcagtcgatcgccgtggccacg
ccgccacaggccgagttcggcggccttccccaccccacgatcctggccgtgtgccggctc
ctgggggttacggaggtctacgcggtcggtggtgcgcaggccgtcgcgatgttcgcctac
ggggtgccgggcctgtgtcgcagggccgacatggtcaccggaccgggaaatatctatgtc
gtggcggccaagcgcctgctgcgcggacggatcggcatcgatgccgaggccggtcccacc
gagatcctcgtgctggccgatgaccgggcgaatccggcctatgtggccgccgacctgatc
agccaggccgagcacgatccgatggccggcgcagtactggtcaccgactcgagcgccctg
ctcacccgggtcgaggaggagttggccgaccaggtcgagcggctcgccacccgggaccgc
ctgaaggtctcactgaccggtgagcagtcaggcgtggtgctggtggccgacatggaccag
ggcatcgatgtggtcaatgactacgctccggagcacctggagatccagaccgtcgatgct
gcggcgctggcccagcgcgtgcgttcggccggggcagtgttcgtgggctcccattccccg
gtgccgttgggcgactattcggccggctcgacgcacgtcctgccgaccgggggagcggca
cacttctcgtccggattgaccacccgcagcttcctcaaggcgatgcatatcatcgactac
tcggcgcaggcgctcggcgccatcggcgacgccgtcgaacagttcgcgcacgccgagcac
ctgcccggccacgccgaggccattgcggtacgcaccggacgagaggtcgaatga

DBGET integrated database retrieval system