KEGG   Propionibacterium freudenreichii: PFREUD_11900Help
Entry
PFREUD_11900      CDS       T01252                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfr01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pfr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1341959..1342819)
Genome map
AA seq 286 aa AA seqDB search
MTTVLDDIITGVRADMAARMAVVAPSQLKERIRWMGPTLDPRPGFGGDTISVISEVKRSS
PSKGALATIEDPATIASAYEAGGAAAISVLTERHRFNGTLDDLRAVREAVGIPVLRKDFV
VDPYQVLEARAFGADLVLLIVAALDDKQLAGLYDLALSLGLLPLIEVHTAEEMRRAALLK
PELVGVNNRNLKTLDVDLAQFERLAPLAPHDAIVVAESGIRDAADVQRVRAAGADVVLVG
EALVTSGNPREAVQTMIEATRPGRGPAGSPGRATVMNDDRQGESNE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtgctcgacgacatcattaccggcgtgcgcgccgacatggcggcccggatg
gccgtggtggcgcccagccagctcaaggaacgcatccgatggatggggccgaccctggac
ccgcgccccgggttcggcggggacacgatctcggtgatctcagaggtcaagcgctcgagt
ccctccaagggcgccctggcgaccattgaggacccggcgacgatcgcctcggcctatgag
gccggcggcgcggcagccatctcggtgctcaccgagaggcaccgcttcaatggcaccctg
gacgacctgcgcgccgtgcgtgaggcggtcgggatcccggtgttgcgcaaggacttcgtc
gtcgacccctaccaggtgctggaagcccgcgccttcggtgccgacctggtactgctgatc
gtggcggcactcgatgacaagcaactcgccggcctctacgacctggccctctcgttgggc
ctgctgcccctcatcgaggtgcacacggccgaggagatgcgtcgggccgcactgctcaag
cccgagctggtgggcgtcaacaaccgcaacctcaagaccctggacgtcgacctcgcccaa
ttcgagcgcctggcaccactggcgccccacgatgccatcgtggtggccgagtcgggcatc
cgcgatgccgccgatgtccagcgggtgcgtgcggccggagccgatgtggtgctggtgggc
gaggccctggtgaccagcggtaatccgcgtgaggccgtgcagacgatgatcgaggcgacc
aggccgggccgcgggcccgcaggatcgccggggagggcgacagtgatgaacgacgacagg
cagggggagagcaatgagtag

DBGET integrated database retrieval system