KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_15110Help
Entry
PFREUD_15110      CDS       T01252                                 

Gene name
tpi1
Definition
(RefSeq) triosephosphate isomerase 1 (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFREUD_15110 (tpi1)
   01230 Biosynthesis of amino acids
    PFREUD_15110 (tpi1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFREUD_15110 (tpi1)
   00051 Fructose and mannose metabolism
    PFREUD_15110 (tpi1)
   00562 Inositol phosphate metabolism
    PFREUD_15110 (tpi1)
Enzymes [BR:pfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PFREUD_15110 (tpi1)
Exosome [BR:pfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PFREUD_15110 (tpi1)
  Exosomal proteins of bladder cancer cells
   PFREUD_15110 (tpi1)
  Exosomal proteins of melanoma cells
   PFREUD_15110 (tpi1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1654549..1655337)
Genome map
AA seq 262 aa AA seqDB search
MARKPIMAGNWKMNLNHIDAVGLVQKLAFTLADKGYDPEQSECVVIPPFTALRTVQTLVE
GDKLPIVYGAQDLSPHDDGAYTGDISSSMLTKLGCSYVVVGHSERREYHAETDEVVNAKA
RKALDAGLTPIICVGESLEVRKAGKHVEHVLAQVTGALAGITAEQAASLVIAYEPIWAIG
TGEVATPEDAQEVCGAIRAAVADLYDAPTGDAVRIQYGGSVKPGTVAAIMAKPDIDGALV
GRASLKADDFAAIVRFYAMAQA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagccgatcatggcgggcaactggaagatgaacctgaaccacatcgacgcc
gtcggtctggtgcagaagctggcgttcacgctggccgacaagggctacgaccccgagcag
tccgaatgcgtggtgatcccgccgttcaccgccctgcgcaccgtgcagacgctcgtcgag
ggcgacaagctgccgatcgtctacggcgcgcaggacctgtcgccccacgatgacggcgcc
tacaccggcgacatcagctcgtcgatgctcaccaagctgggttgcagctatgtggtcgtc
gggcactcggagcggcgcgagtaccacgccgagaccgacgaggtcgtcaacgcgaaggcc
cgcaaggccctcgacgccggcctgacgccgatcatctgcgtgggcgagagcctggaggtg
cgcaaggccggcaagcacgtcgagcacgtgttggcccaggtcaccggcgcgctggccggc
atcacggccgagcaggctgcctccctggtgatcgcctatgagcccatctgggccatcggc
accggcgaggtggcgacccccgaggacgcccaggaggtctgcggcgccatccgtgccgcc
gtggcggacctgtacgacgccccgaccggggacgccgtgcgcatccagtacggcggctcc
gtgaagcccggcaccgtggcggccatcatggcgaagcccgacatcgacggcgcactggtc
ggtcgcgccagcctcaaggccgatgatttcgccgccatcgtgcgcttctacgcgatggca
caggcctga

DBGET integrated database retrieval system