KEGG   Propionibacterium freudenreichii: PFREUD_15940Help
Entry
PFREUD_15940      CDS       T01252                                 

Gene name
pdhB
Definition
dihydrolipoamide acyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFREUD_15940 (pdhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFREUD_15940 (pdhB)
  Amino acid metabolism
   00310 Lysine degradation
    PFREUD_15940 (pdhB)
Enzymes [BR:pfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PFREUD_15940 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1743957..1745726
Genome map
AA seq 589 aa AA seqDB search
MSTEVTLPELGESVTEATVSRWLKEVGDHVDADEPLLEVSTDKVDTEIPSPVAGTLLEIK
FNEDDTAPVGAVLAVVGDPAEAPAGAPAPAAPAPAAAPVPPPPPIPAAAAAPVAPPAPPA
PAAAAPAAAPAGQGTPVTLPELGESVTEATVSRWLKEVGDPVEADEPLLEVSTDKVDTEI
PSPVAGTLTEIHVKEDETAEVGSVLGVVGSSVPAAPAAAPAAPAAPAAPVAPPAPAVPVA
APAPVAPPAPVAPSAPVAAPPAAPTPAAAVPVNPPAPRATEGAAFTGYVTPLVRKLAQQN
DVDLNQVTGTGVGGRIRKQDVLDAAAAKQKAAAAPARPKAAPSPDAGKRGTTEKMSNLRK
IVASRMTESLQTSAQLTATVEVDLSAVARVRAKAKDDFRKREGVGLTYLAFITQAATEAL
RQYPKVNASIDTEAGTITYHDSEDIGIAVDTPKGLMVPVIKGAGDLNVGGVAKSIGDLAA
RARDGKIGPDELSGATFTITNYGSTGTLFDTPIINLPNAAILGTGAMVKRPVVVSDEYGN
DTIAIRPMMYLSMTYDHRLVDGADASRFLSFVKARLEEGDFGAEFGLNQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcacactgcccgagctgggtgaaagcgtcacagaggccacagtctcg
aggtggctgaaggaagttggggaccacgtcgacgctgacgagcccctgctggaggtgagc
accgacaaggtggacaccgagattccgtcgcccgtcgctggcaccctgcttgagatcaag
ttcaatgaggacgacaccgcgccggtcggcgccgtgctcgccgtggtgggtgacccggcc
gaggctcctgcgggcgcaccggccccggcagcccccgcccccgcagctgcgcccgttccg
ccgccgcccccgattcccgcagccgccgcggccccggtcgccccgcctgctccccctgca
cccgctgctgcggcacccgctgcggcacctgccggccagggcaccccggtgaccctgccc
gagctcggcgagagcgttacggaggccaccgtctcgcgctggctcaaggaggtcggtgat
ccggtcgaggccgatgagccgctcctggaggtcagcaccgacaaggtggacaccgagatc
ccctcaccggtcgccggcaccctgacggagatccacgtcaaggaggacgagaccgccgag
gtgggctccgtactcggcgtcgtcggctcatccgtgcctgctgcaccggctgctgcaccg
gccgcccctgcggcacccgccgcacccgttgccccgcctgctcccgcagtccccgtggcg
gctccggcccccgttgcccctccggccccggtggccccgtccgcccctgtggcggccccg
cccgcggcgccgaccccggcagcggccgtcccggtgaacccaccggctccccgggccacc
gagggtgccgcgttcaccggctatgtcaccccgttggtgcgcaagctcgcccagcagaac
gacgttgacctcaaccaggtgaccggcaccggcgtgggtggtcgtatccgcaagcaggac
gtcctggacgctgcagctgccaagcagaaggccgctgccgcccccgcgcgtcccaaggcc
gcaccgtcgccggatgccggcaagcgcggcaccactgagaagatgtcgaacctccgcaag
atcgtggcgagccgcatgaccgagtcgctgcagacctcggcccagctcaccgccacggtg
gaggtcgacctgtcggccgttgcgcgggtgcgcgccaaggcgaaggacgacttccgcaag
cgcgagggcgtcggcctgacctatctggccttcatcacccaggcggccaccgaggcgctg
cgccagtacccgaaggtgaacgcctccatcgataccgaggccggaaccatcacctaccac
gactccgaggacatcggcatcgcggtcgatacgcccaagggcctcatggtcccggtgatc
aagggtgccggtgacctcaacgttggtggcgtggccaagtcgatcggtgacctggccgcc
cgtgcccgtgacggcaagatcggccccgacgagctgtcgggggcaaccttcaccatcacc
aactacgggtccaccggcacgctgttcgacaccccgatcatcaacctgccgaatgccgcc
atcctgggcaccggcgcgatggtcaagcgtcccgtggtggtcagcgacgaatacggcaac
gacaccatcgccatccggccgatgatgtacctgtcgatgacctacgaccaccgcctggtg
gacggcgcggacgcctcacgcttcctgtcgttcgtcaaggcccgccttgaggagggcgac
ttcggggctgagttcggtctgaaccagtag

DBGET integrated database retrieval system