KEGG   Propionibacterium freudenreichii: PFREUD_15940Help
Entry
PFREUD_15940      CDS       T01252                                 

Gene name
pdhB
Definition
dihydrolipoamide acyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFREUD_15940 (pdhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFREUD_15940 (pdhB)
  Amino acid metabolism
   00310 Lysine degradation
    PFREUD_15940 (pdhB)
Enzymes [BR:pfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PFREUD_15940 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1743957..1745726
Genome map
AA seq 589 aa AA seqDB search
MSTEVTLPELGESVTEATVSRWLKEVGDHVDADEPLLEVSTDKVDTEIPSPVAGTLLEIK
FNEDDTAPVGAVLAVVGDPAEAPAGAPAPAAPAPAAAPVPPPPPIPAAAAAPVAPPAPPA
PAAAAPAAAPAGQGTPVTLPELGESVTEATVSRWLKEVGDPVEADEPLLEVSTDKVDTEI
PSPVAGTLTEIHVKEDETAEVGSVLGVVGSSVPAAPAAAPAAPAAPAAPVAPPAPAVPVA
APAPVAPPAPVAPSAPVAAPPAAPTPAAAVPVNPPAPRATEGAAFTGYVTPLVRKLAQQN
DVDLNQVTGTGVGGRIRKQDVLDAAAAKQKAAAAPARPKAAPSPDAGKRGTTEKMSNLRK
IVASRMTESLQTSAQLTATVEVDLSAVARVRAKAKDDFRKREGVGLTYLAFITQAATEAL
RQYPKVNASIDTEAGTITYHDSEDIGIAVDTPKGLMVPVIKGAGDLNVGGVAKSIGDLAA
RARDGKIGPDELSGATFTITNYGSTGTLFDTPIINLPNAAILGTGAMVKRPVVVSDEYGN
DTIAIRPMMYLSMTYDHRLVDGADASRFLSFVKARLEEGDFGAEFGLNQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcacactgcccgagctgggtgaaagcgtcacagaggccacagtctcg
aggtggctgaaggaagttggggaccacgtcgacgctgacgagcccctgctggaggtgagc
accgacaaggtggacaccgagattccgtcgcccgtcgctggcaccctgcttgagatcaag
ttcaatgaggacgacaccgcgccggtcggcgccgtgctcgccgtggtgggtgacccggcc
gaggctcctgcgggcgcaccggccccggcagcccccgcccccgcagctgcgcccgttccg
ccgccgcccccgattcccgcagccgccgcggccccggtcgccccgcctgctccccctgca
cccgctgctgcggcacccgctgcggcacctgccggccagggcaccccggtgaccctgccc
gagctcggcgagagcgttacggaggccaccgtctcgcgctggctcaaggaggtcggtgat
ccggtcgaggccgatgagccgctcctggaggtcagcaccgacaaggtggacaccgagatc
ccctcaccggtcgccggcaccctgacggagatccacgtcaaggaggacgagaccgccgag
gtgggctccgtactcggcgtcgtcggctcatccgtgcctgctgcaccggctgctgcaccg
gccgcccctgcggcacccgccgcacccgttgccccgcctgctcccgcagtccccgtggcg
gctccggcccccgttgcccctccggccccggtggccccgtccgcccctgtggcggccccg
cccgcggcgccgaccccggcagcggccgtcccggtgaacccaccggctccccgggccacc
gagggtgccgcgttcaccggctatgtcaccccgttggtgcgcaagctcgcccagcagaac
gacgttgacctcaaccaggtgaccggcaccggcgtgggtggtcgtatccgcaagcaggac
gtcctggacgctgcagctgccaagcagaaggccgctgccgcccccgcgcgtcccaaggcc
gcaccgtcgccggatgccggcaagcgcggcaccactgagaagatgtcgaacctccgcaag
atcgtggcgagccgcatgaccgagtcgctgcagacctcggcccagctcaccgccacggtg
gaggtcgacctgtcggccgttgcgcgggtgcgcgccaaggcgaaggacgacttccgcaag
cgcgagggcgtcggcctgacctatctggccttcatcacccaggcggccaccgaggcgctg
cgccagtacccgaaggtgaacgcctccatcgataccgaggccggaaccatcacctaccac
gactccgaggacatcggcatcgcggtcgatacgcccaagggcctcatggtcccggtgatc
aagggtgccggtgacctcaacgttggtggcgtggccaagtcgatcggtgacctggccgcc
cgtgcccgtgacggcaagatcggccccgacgagctgtcgggggcaaccttcaccatcacc
aactacgggtccaccggcacgctgttcgacaccccgatcatcaacctgccgaatgccgcc
atcctgggcaccggcgcgatggtcaagcgtcccgtggtggtcagcgacgaatacggcaac
gacaccatcgccatccggccgatgatgtacctgtcgatgacctacgaccaccgcctggtg
gacggcgcggacgcctcacgcttcctgtcgttcgtcaaggcccgccttgaggagggcgac
ttcggggctgagttcggtctgaaccagtag

DBGET integrated database retrieval system