KEGG   Propionibacterium freudenreichii: PFREUD_16240Help
Entry
PFREUD_16240      CDS       T01252                                 

Gene name
dapE2
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFREUD_16240 (dapE2)
  Amino acid metabolism
   00300 Lysine biosynthesis
    PFREUD_16240 (dapE2)
Enzymes [BR:pfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PFREUD_16240 (dapE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1778749..1779837)
Genome map
AA seq 362 aa AA seqDB search
MTLDTRDLHRLFAQIVDIESVSRNEERLADAVQAVLEPCGHLEVTRHGNSVVARTHLGRA
QRMIIAGHLDTVPVADNLPSRLEHRPDGDYLVGRGTADMKGGIAVMVQLATQLAEPVHDV
TWVFYECEEIEAAANGLTKIAAAQPQWLAGDFAVLMEPTSARIEGGCQGTTRFLLTTHGV
AAHSARSWLGHNAIHDLTPLLQRIQAFPVRRVMVEGLEYREGLNATIVSGGVAGNMIPDR
AQLQVNYRFAPDLDADRALARMRELFDLPDVDFEVLDLSPAARPGLDRPEARGFLQAVGG
TPGPKYGWTDVARFGQLGIPAVNYGPADAGKAHAVDECCPLADLDTCAGALTTWLTNRAP
DR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggataccagggacctgcaccgactgttcgcccagatcgtcgacatcgagtcg
gtcagccgcaatgaggaacgcctggccgacgccgtgcaggcggtgctcgagccgtgcggc
cacctcgaggtgacgcgccacggcaacagcgtggtggcgcgcacgcacctggggcgcgcg
caacgcatgatcatcgccggtcacctggacacggtgccggtggccgacaacctgcccagc
aggctggagcaccgccccgacggtgactacctggtgggacgcggcaccgccgacatgaag
ggcgggatcgccgtcatggtgcagctggccacccaactggccgagcccgtccacgacgtc
acctgggtgttctatgagtgcgaggagatcgaggccgccgccaacggcctgaccaagatc
gccgcggcccagccacagtggttggccggtgacttcgcggtgttgatggagcccaccagc
gcccgcatcgagggcggctgccagggcacgacgcgcttcctgctgaccacccatggcgtg
gcggcccattccgcgcgcagttggctgggccacaacgcgatccacgacctgacgccgttg
ctgcagcgcatccaggccttcccggtgcgccgcgtcatggtcgagggactggagtaccgc
gagggcctcaacgccaccatcgtcagcgggggagtggccggcaatatgatccccgaccgt
gcccagctgcaggtgaactaccgcttcgcgcccgacctggacgccgaccgggcactggcc
cggatgcgcgagctgttcgacctgcccgatgtcgacttcgaggtgctcgacctgtctccg
gcggcccgtcccggcctggaccgtcccgaggcacgcggcttcctgcaggcggtcggtggc
acgcccggccccaaatacggctggacggatgtggcgcgtttcgggcagctgggcattccg
gcggtcaactatggacccgccgatgccggcaaggcccatgcggtggacgaatgctgcccc
ctggccgacctcgacacatgcgccggcgcactgaccacgtggctgacgaaccgggcgccc
gaccggtga

DBGET integrated database retrieval system