KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_16240Help
Entry
PFREUD_16240      CDS       T01252                                 

Gene name
dapE2
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00300  Lysine biosynthesis
pfr01100  Metabolic pathways
pfr01120  Microbial metabolism in diverse environments
pfr01230  Biosynthesis of amino acids
Module
pfr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PFREUD_16240 (dapE2)
Enzymes [BR:pfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PFREUD_16240 (dapE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 AlkA_N
Motif
Other DBs
NCBI-ProteinID: CBL57122
UniProt: D7GF11
Position
complement(1778749..1779837)
Genome map
AA seq 362 aa AA seqDB search
MTLDTRDLHRLFAQIVDIESVSRNEERLADAVQAVLEPCGHLEVTRHGNSVVARTHLGRA
QRMIIAGHLDTVPVADNLPSRLEHRPDGDYLVGRGTADMKGGIAVMVQLATQLAEPVHDV
TWVFYECEEIEAAANGLTKIAAAQPQWLAGDFAVLMEPTSARIEGGCQGTTRFLLTTHGV
AAHSARSWLGHNAIHDLTPLLQRIQAFPVRRVMVEGLEYREGLNATIVSGGVAGNMIPDR
AQLQVNYRFAPDLDADRALARMRELFDLPDVDFEVLDLSPAARPGLDRPEARGFLQAVGG
TPGPKYGWTDVARFGQLGIPAVNYGPADAGKAHAVDECCPLADLDTCAGALTTWLTNRAP
DR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggataccagggacctgcaccgactgttcgcccagatcgtcgacatcgagtcg
gtcagccgcaatgaggaacgcctggccgacgccgtgcaggcggtgctcgagccgtgcggc
cacctcgaggtgacgcgccacggcaacagcgtggtggcgcgcacgcacctggggcgcgcg
caacgcatgatcatcgccggtcacctggacacggtgccggtggccgacaacctgcccagc
aggctggagcaccgccccgacggtgactacctggtgggacgcggcaccgccgacatgaag
ggcgggatcgccgtcatggtgcagctggccacccaactggccgagcccgtccacgacgtc
acctgggtgttctatgagtgcgaggagatcgaggccgccgccaacggcctgaccaagatc
gccgcggcccagccacagtggttggccggtgacttcgcggtgttgatggagcccaccagc
gcccgcatcgagggcggctgccagggcacgacgcgcttcctgctgaccacccatggcgtg
gcggcccattccgcgcgcagttggctgggccacaacgcgatccacgacctgacgccgttg
ctgcagcgcatccaggccttcccggtgcgccgcgtcatggtcgagggactggagtaccgc
gagggcctcaacgccaccatcgtcagcgggggagtggccggcaatatgatccccgaccgt
gcccagctgcaggtgaactaccgcttcgcgcccgacctggacgccgaccgggcactggcc
cggatgcgcgagctgttcgacctgcccgatgtcgacttcgaggtgctcgacctgtctccg
gcggcccgtcccggcctggaccgtcccgaggcacgcggcttcctgcaggcggtcggtggc
acgcccggccccaaatacggctggacggatgtggcgcgtttcgggcagctgggcattccg
gcggtcaactatggacccgccgatgccggcaaggcccatgcggtggacgaatgctgcccc
ctggccgacctcgacacatgcgccggcgcactgaccacgtggctgacgaaccgggcgccc
gaccggtga

DBGET integrated database retrieval system