KEGG   Propionibacterium freudenreichii: PFREUD_16240Help
Entry
PFREUD_16240      CDS       T01252                                 

Gene name
dapE2
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pfr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1778749..1779837)
Genome map
AA seq 362 aa AA seqDB search
MTLDTRDLHRLFAQIVDIESVSRNEERLADAVQAVLEPCGHLEVTRHGNSVVARTHLGRA
QRMIIAGHLDTVPVADNLPSRLEHRPDGDYLVGRGTADMKGGIAVMVQLATQLAEPVHDV
TWVFYECEEIEAAANGLTKIAAAQPQWLAGDFAVLMEPTSARIEGGCQGTTRFLLTTHGV
AAHSARSWLGHNAIHDLTPLLQRIQAFPVRRVMVEGLEYREGLNATIVSGGVAGNMIPDR
AQLQVNYRFAPDLDADRALARMRELFDLPDVDFEVLDLSPAARPGLDRPEARGFLQAVGG
TPGPKYGWTDVARFGQLGIPAVNYGPADAGKAHAVDECCPLADLDTCAGALTTWLTNRAP
DR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggataccagggacctgcaccgactgttcgcccagatcgtcgacatcgagtcg
gtcagccgcaatgaggaacgcctggccgacgccgtgcaggcggtgctcgagccgtgcggc
cacctcgaggtgacgcgccacggcaacagcgtggtggcgcgcacgcacctggggcgcgcg
caacgcatgatcatcgccggtcacctggacacggtgccggtggccgacaacctgcccagc
aggctggagcaccgccccgacggtgactacctggtgggacgcggcaccgccgacatgaag
ggcgggatcgccgtcatggtgcagctggccacccaactggccgagcccgtccacgacgtc
acctgggtgttctatgagtgcgaggagatcgaggccgccgccaacggcctgaccaagatc
gccgcggcccagccacagtggttggccggtgacttcgcggtgttgatggagcccaccagc
gcccgcatcgagggcggctgccagggcacgacgcgcttcctgctgaccacccatggcgtg
gcggcccattccgcgcgcagttggctgggccacaacgcgatccacgacctgacgccgttg
ctgcagcgcatccaggccttcccggtgcgccgcgtcatggtcgagggactggagtaccgc
gagggcctcaacgccaccatcgtcagcgggggagtggccggcaatatgatccccgaccgt
gcccagctgcaggtgaactaccgcttcgcgcccgacctggacgccgaccgggcactggcc
cggatgcgcgagctgttcgacctgcccgatgtcgacttcgaggtgctcgacctgtctccg
gcggcccgtcccggcctggaccgtcccgaggcacgcggcttcctgcaggcggtcggtggc
acgcccggccccaaatacggctggacggatgtggcgcgtttcgggcagctgggcattccg
gcggtcaactatggacccgccgatgccggcaaggcccatgcggtggacgaatgctgcccc
ctggccgacctcgacacatgcgccggcgcactgaccacgtggctgacgaaccgggcgccc
gaccggtga

DBGET integrated database retrieval system