KEGG   Propionibacterium freudenreichii: PFREUD_18070Help
Entry
PFREUD_18070      CDS       T01252                                 

Gene name
ugpA
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PFREUD_18070 (ugpA)
   00052 Galactose metabolism
    PFREUD_18070 (ugpA)
   00500 Starch and sucrose metabolism
    PFREUD_18070 (ugpA)
   00520 Amino sugar and nucleotide sugar metabolism
    PFREUD_18070 (ugpA)
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PFREUD_18070 (ugpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1951462..1952835)
Genome map
AA seq 457 aa AA seqDB search
MSEQGLQQARDKMASAGVGRTAIEVFSDYYKQLETGATGIIPESSIRPIENPPSLADVVV
TDQQARDALSKTVFIKLNGGLGTSMGLAHAKSLLQVRDGKSFLDIVVQQVRATRQQWGVK
LPLLLMDSFSTHDDTMAALAEYPDLAVDGLPLDFLQSKEPKLRADDLSPVDWPADPELEW
CPPGHGDIYAALYDSGLLSTLIDKGYRYAAVSNSDNLGAAPNARIAGWFASTGGDWCSEV
CVRTVNDKKGGHLAIRKSDGRVILRDTAQTAPEDMKYFTDEHVHRYFHANNLWWDLVALK
QKLDERHGVMGLPLIRNEKTVDPTDPSSPAVIQVESAMGAAVEVFDDARVLLVGRDRFVP
VKKTNELLLLRSDVYSIGDDGRLHARVERIPGVDLGADYKFVDDFDERIPAPLGMVEATS
LTVEGDWHFGTGVRVRGTVDLGPDGGTVPDGELLQGD
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaggtcttcagcaggcgcgggacaagatggcgtccgccggcgtcggacgc
accgccatcgaggtgttcagcgactactacaagcagttggaaaccggtgccaccggcatc
atccccgagagcagtatccggcccatcgagaaccccccaagcctggccgatgtggtggtt
accgaccagcaggcccgtgacgccttgtcgaagacggtgttcatcaagctcaacgggggg
ctcggcacgtcgatggggctggcccatgcaaagtccctgctgcaggtgcgcgacggcaag
agcttcctcgacatcgtggtgcagcaggtgcgcgccacccgccagcaatggggcgtcaag
ctgccgctgctgctgatggactccttcagtacccatgacgacacgatggcggcccttgcc
gaatatcccgacctggcggtggatggcctgcccctggacttcctgcagagcaaggaaccc
aagctgcgggccgacgacctctctccggtcgactggcccgctgaccccgagctggagtgg
tgtccgccgggccatggtgacatctacgccgcgctgtacgactcgggcctgctgtccacg
ctgatcgacaagggatatcgctatgcggcggtgtccaactccgacaacctgggggcggcc
cccaacgcgaggatcgccggttggttcgcgtccaccggcggcgactggtgctccgaggtg
tgcgtgcgcacggtgaacgacaagaagggcgggcacctggcgatccgcaagtccgacggt
cgggtgatccttcgggacacggcccagaccgcacccgaggacatgaagtacttcaccgac
gagcatgtgcaccgctacttccacgccaacaacctgtggtgggacctggtggccctcaag
cagaagctcgatgagcgacacggggtgatgggcctacccctcatccgcaatgagaagacg
gtggaccccaccgacccgagcagcccggccgtgatccaggtggagagcgccatgggtgct
gcggtggaggtgttcgatgacgcgcgcgtgctgctggtgggtcgtgatcgcttcgtgccg
gtgaagaagaccaacgagctgctgttgctgcgctccgatgtctactcgatcggtgatgac
ggccggctgcacgcccgggtcgagcgcattccgggtgttgacctgggtgctgactacaag
ttcgtcgacgacttcgacgagcgcatccccgccccgctggggatggtggaggccacgtcg
ttgaccgtcgagggcgactggcacttcggtaccggcgtgcgtgtgcgcgggacagttgac
ctgggcccggatggcggcacggtgcccgacggggagctgttgcagggtgactag

DBGET integrated database retrieval system