KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_18070Help
Entry
PFREUD_18070      CDS       T01252                                 

Gene name
ugpA
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PFREUD_18070 (ugpA)
   00052 Galactose metabolism
    PFREUD_18070 (ugpA)
   00500 Starch and sucrose metabolism
    PFREUD_18070 (ugpA)
   00520 Amino sugar and nucleotide sugar metabolism
    PFREUD_18070 (ugpA)
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PFREUD_18070 (ugpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1951462..1952835)
Genome map
AA seq 457 aa AA seqDB search
MSEQGLQQARDKMASAGVGRTAIEVFSDYYKQLETGATGIIPESSIRPIENPPSLADVVV
TDQQARDALSKTVFIKLNGGLGTSMGLAHAKSLLQVRDGKSFLDIVVQQVRATRQQWGVK
LPLLLMDSFSTHDDTMAALAEYPDLAVDGLPLDFLQSKEPKLRADDLSPVDWPADPELEW
CPPGHGDIYAALYDSGLLSTLIDKGYRYAAVSNSDNLGAAPNARIAGWFASTGGDWCSEV
CVRTVNDKKGGHLAIRKSDGRVILRDTAQTAPEDMKYFTDEHVHRYFHANNLWWDLVALK
QKLDERHGVMGLPLIRNEKTVDPTDPSSPAVIQVESAMGAAVEVFDDARVLLVGRDRFVP
VKKTNELLLLRSDVYSIGDDGRLHARVERIPGVDLGADYKFVDDFDERIPAPLGMVEATS
LTVEGDWHFGTGVRVRGTVDLGPDGGTVPDGELLQGD
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaggtcttcagcaggcgcgggacaagatggcgtccgccggcgtcggacgc
accgccatcgaggtgttcagcgactactacaagcagttggaaaccggtgccaccggcatc
atccccgagagcagtatccggcccatcgagaaccccccaagcctggccgatgtggtggtt
accgaccagcaggcccgtgacgccttgtcgaagacggtgttcatcaagctcaacgggggg
ctcggcacgtcgatggggctggcccatgcaaagtccctgctgcaggtgcgcgacggcaag
agcttcctcgacatcgtggtgcagcaggtgcgcgccacccgccagcaatggggcgtcaag
ctgccgctgctgctgatggactccttcagtacccatgacgacacgatggcggcccttgcc
gaatatcccgacctggcggtggatggcctgcccctggacttcctgcagagcaaggaaccc
aagctgcgggccgacgacctctctccggtcgactggcccgctgaccccgagctggagtgg
tgtccgccgggccatggtgacatctacgccgcgctgtacgactcgggcctgctgtccacg
ctgatcgacaagggatatcgctatgcggcggtgtccaactccgacaacctgggggcggcc
cccaacgcgaggatcgccggttggttcgcgtccaccggcggcgactggtgctccgaggtg
tgcgtgcgcacggtgaacgacaagaagggcgggcacctggcgatccgcaagtccgacggt
cgggtgatccttcgggacacggcccagaccgcacccgaggacatgaagtacttcaccgac
gagcatgtgcaccgctacttccacgccaacaacctgtggtgggacctggtggccctcaag
cagaagctcgatgagcgacacggggtgatgggcctacccctcatccgcaatgagaagacg
gtggaccccaccgacccgagcagcccggccgtgatccaggtggagagcgccatgggtgct
gcggtggaggtgttcgatgacgcgcgcgtgctgctggtgggtcgtgatcgcttcgtgccg
gtgaagaagaccaacgagctgctgttgctgcgctccgatgtctactcgatcggtgatgac
ggccggctgcacgcccgggtcgagcgcattccgggtgttgacctgggtgctgactacaag
ttcgtcgacgacttcgacgagcgcatccccgccccgctggggatggtggaggccacgtcg
ttgaccgtcgagggcgactggcacttcggtaccggcgtgcgtgtgcgcgggacagttgac
ctgggcccggatggcggcacggtgcccgacggggagctgttgcagggtgactag

DBGET integrated database retrieval system