KEGG   Propionibacterium freudenreichii: PFREUD_21500Help
Entry
PFREUD_21500      CDS       T01252                                 

Gene name
malQ2
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFREUD_21500 (malQ2)
Enzymes [BR:pfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PFREUD_21500 (malQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2317209..2319164
Genome map
AA seq 651 aa AA seqDB search
MSTHRKPGTPASPDGARGQQPDHPRFIRPAPDGPVQRAALLRRLVPLGVNGTYIDAAGRE
IRVPTATLELVSAAFEDSLPRGIGPALVCTPGRYHPELFGTLVPEDGGPVQAHGVVNTPG
YHVLYTVRGVRRLVIATPEHLREPQRSWGWQVQLYAARSRDSWGIGDFRDLGQICRIAAQ
QGAQCVQVSPVHAIAPVSHPKDSPYSPASRHFLNLLHIAPGFAPGAERVNLSDLSARGRA
LNDERLIDRTAVWALKREALERIWQAVRDEPNIEFREFRRHRGRALTRFATWSAIAEDLD
SPDWPDWPTELHNPEGVDVARYAHEHADRVNFFSWCQWVADWQYGRACTEGVDVIADLAV
GFDRGSEDAWAFHGQLCFDFEIGAPPDEHNQDGQRWGLPPFSPQMEERTDFAAFRDMVAR
GLAHTHALRIDHVMQLWRLFWIPRDADPADGAYVHYPVHALLAILRLEAMRTNAWIVGED
MGTVAPGMRETMHGIGMLSNCSAVRTPIADFPELALGTSSTHDQVTIAGLLTGADAAELR
RIGKRSDWAQIERSRRKLAEMAHIDPAKPAHRISNADIHAAVVARYRLLAQSPSRVVLAS
LDDAAAVRERPNVPGTIDEYPNWRLALPEPIDTLLNAPLARDVVAVMRETR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgtccacgcacaggaagcccggcaccccggcgtccccggatggcgcccggggccaacag
cccgaccatccccgtttcatccggccggcccccgacggccctgtccaacgcgccgcgctc
ctgcgccgactggtgccgctgggcgtcaacggcacctacatcgacgccgccggccgggag
atccgcgtgcccaccgccaccctcgaactggtcagtgcagccttcgaggactcgctgccc
cgcgggatcggtccggcgctggtgtgcacccccgggcgctaccaccccgagctgttcggc
acgctcgtgcccgaggacggcggcccggtgcaggcccacggcgtcgtcaacacgccgggc
tatcacgtgctgtacaccgtgaggggcgtccgacggctggtcatcgccacccccgagcac
ttgcgtgaaccgcaacgctcatggggctggcaggtgcagctctatgccgcccgctcccgc
gattcatggggcatcggcgacttccgcgacctcggccagatctgtcgcatcgccgcccag
cagggcgcccagtgcgtgcaggtgtcgccggtgcatgccatcgcgccggtctcccatccc
aaggactcgccctattcgccggcgagccgccatttcctcaacctgctgcacatcgcaccc
ggcttcgcgccgggggcggagcgggtgaacctgtccgacctgtcggcacgggggcgcgcc
ctcaacgatgagcggctgatcgaccgcaccgccgtgtgggccctcaagcgggaggcgctg
gaacgcatctggcaggcggtgcgcgacgagcccaacatcgagttccgtgagttccgccgc
caccgcggacgggcactcacccggttcgccacctggtcggccatcgccgaggacctcgac
agccccgactggcccgactggcccaccgaactgcacaaccccgagggcgtcgacgtggcc
cgctacgcccacgaacatgccgaccgcgtgaatttcttcagctggtgccagtgggtggcc
gactggcaatacggacgcgcctgcaccgagggcgtcgatgtgattgctgacctggcagtg
ggcttcgatcgcggcagtgaggatgcctgggccttccatggccagctgtgcttcgacttc
gagatcggtgccccacccgacgagcacaatcaggacggccagcgctggggacttcctccg
ttcagcccgcagatggaggaacgcaccgacttcgccgccttccgtgacatggtggcccgc
ggcctggcccacacccacgcgctgcgcatcgaccacgtgatgcagctgtggcggctgttc
tggattccccgcgacgccgaccccgccgatggtgcctatgtgcactatccggtgcatgcg
ctgctcgcgatcctgcgcctggaggcgatgcgcaccaacgcctggatcgtcggtgaggac
atgggtacggtggctcccggaatgcgcgagacgatgcacggcatcggcatgctgtcgaac
tgttcggcggtgcgcacgcccatcgcggacttccccgagttggcgctggggacgtcgtcc
acgcacgatcaggtgacgatcgccgggctgctcaccggcgccgatgccgccgaactgcga
cgcatcggcaagcgttccgactgggcgcagatcgagcgcagccgccgcaagctggccgag
atggcccatattgaccccgccaagccggcgcaccgcatcagcaacgccgacatccatgcc
gccgtggtggcgcgctaccggttgctggcccagtcgcccagccgcgtggtgcttgccagc
ctcgacgacgccgccgcggtgcgcgagcgtcccaatgtgcccggcaccattgacgaatac
cccaactggcgtcttgcgctgcccgaacccatcgacaccctgttgaacgcccccctcgcc
cgcgatgtggtagcggtgatgcgcgagacgcgatga

DBGET integrated database retrieval system