KEGG   Propionibacterium freudenreichii: PFREUD_22330Help
Entry
PFREUD_22330      CDS       T01252                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFREUD_22330
Enzymes [BR:pfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PFREUD_22330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2405032..2405928
Genome map
AA seq 298 aa AA seqDB search
MQDITLPEGLRLNEESPTNDQSGAGFATIDVSTRLCTGRIHLHGAQVTAWQPRGASEPVF
WQSAQAKLASDKAIRGGVPISFPWFADGRSHNQKPAHGLARLADWKLVDASSTPGGEVTV
RLRLDDETLAKSKFAPDAEVTLVVTMGVAVQMSLVVRAGSAACHFEDAMHNYFHVGDVTR
ASVKGLDAARYLDKVSGRDGQLQEGPVTFSGETDRVYQSVASTSIVDPVLNRTIRIEKSG
SESTVVWNPWSKRSEKDFGMAPGEWQQMVCVETANALADEVYLEAGEKHVLSQVISLG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacatcacacttcctgaggggctgcgtctcaacgaagagagccccaccaatgac
cagtccggagctgggttcgccaccatcgacgtgtcgacgcgcctgtgcaccggacgcatc
cacctgcatggcgcccaggtgaccgcctggcagccgcgtggcgccagcgagccggtgttc
tggcagagcgcccaggccaaattggcctctgacaaggcgattcgtggcggggttccgatc
tcgttcccgtggttcgccgatggccgctcacacaatcagaagccggcccacggcctggca
cgactggccgattggaagctcgtcgacgcctcctcgacgcccggtggcgaggtgacggtg
cgcctgcgcctcgacgacgagacgctggcgaagtcgaagttcgcgcccgacgccgaggtg
acgctggtggtgaccatgggcgtggccgtccagatgtcgctggtggtgcgcgccggcagc
gccgcgtgccatttcgaggacgcgatgcacaactacttccatgtgggcgatgtcacccgg
gccagcgtcaagggactggacgccgcgcgctacctggacaaggtgagcggacgcgacggc
cagctgcaggagggaccagtgaccttcagcggcgagaccgaccgcgtctaccagtcggtg
gccagcacctcgatcgtcgacccggtgctcaaccgcacgatccgcatcgagaagagcggc
tcggagagcaccgtggtgtggaacccgtggagcaagcgcagcgagaaggacttcggcatg
gcgccgggcgaatggcagcagatggtctgcgtcgagaccgccaatgcgctggccgacgag
gtctacctcgaggccggcgagaagcatgtgctcagccaggtgatctcgttgggctga

DBGET integrated database retrieval system