KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_22460Help
Entry
PFREUD_22460      CDS       T01252                                 

Gene name
tpi2
Definition
(GenBank) Triosephosphate isomerase 2 (EC 5.3.1.1)
  KO
K20905  
L-erythrulose 4-phosphate epimerase [EC:5.1.3.39]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Brite
Enzymes [BR:pfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.39  L-erythrulose 4-phosphate epimerase
     PFREUD_22460 (tpi2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2421966..2422718)
Genome map
AA seq 250 aa AA seqDB search
MLWVGTSWKMNGTRASSRTYVEALKQADHSAWDGVQAFIIPPATVLAEVSELLGPDSDVL
LGAQNAHWADAGAWTGEVSVPQVADAGAQLVEVGHSERRANFGDTDEVVNKKVRAIIGHG
LRPVLCVGESQEVFDAGDSVKFITDQADSALQGVDPSSVVLAYEPIWAIGEHGREPQRDD
LLRAFDALQSRYGDAVTAVIYGGSANPGNARELLGIPGVEGLFIGRAAWTGPGYVQMLGI
AGEVARAHQG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggttggaaccagctggaagatgaacggcacgcgtgcgtcgtcacgcacctat
gtggaggcgctcaagcaggccgaccacagcgcctgggacggggtgcaggccttcatcatc
ccgccggccaccgtgctggccgaggtcagcgagctgctcggccccgactccgatgtgctg
ctgggcgcgcagaacgcgcactgggccgacgccggcgcatggaccggtgaggtctccgtg
ccgcaggtcgccgacgccggggcacaactggtggaggtgggccactccgagcgtcgtgcg
aacttcggtgacaccgacgaggtggtcaacaagaaggtgcgcgcgatcatcggccacggc
ctgcgtcccgtgctgtgcgtgggcgaatcccaggaggtcttcgacgccggcgactcggtg
aagttcatcaccgatcaggccgattccgccctgcagggcgtcgacccctcgtcggtggtc
ctggcctacgagcccatctgggcgatcggcgagcatggacgcgaaccgcagcgcgacgac
ctcctgcgtgccttcgacgcactgcagtcgcgctacggcgacgcggtgaccgcagtgatc
tacggcggctccgcgaatccgggcaatgcccgcgagctgctggggatccccggcgtggag
ggcctgttcatcgggcgcgccgcctggaccggccccggctatgtgcagatgctcggcatc
gccggcgaggtcgcccgcgcccaccagggatga

DBGET integrated database retrieval system