KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_24080Help
Entry
PFREUD_24080      CDS       T01252                                 

Gene name
gpm1
Definition
(RefSeq) phosphoglycerate mutase/fructose-2,6-bisphosphatase (EC:2.7.1.105 3.1.3.46 5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFREUD_24080 (gpm1)
   01230 Biosynthesis of amino acids
    PFREUD_24080 (gpm1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFREUD_24080 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    PFREUD_24080 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFREUD_24080 (gpm1)
Enzymes [BR:pfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PFREUD_24080 (gpm1)
Exosome [BR:pfr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PFREUD_24080 (gpm1)
  Exosomal proteins of melanoma cells
   PFREUD_24080 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2603738..2604457
Genome map
AA seq 239 aa AA seqDB search
MKLLLIRHGQSANNALSGANHPVSSQYPDPTLTDLGRQQAETLAHAFTDGLLPRPSVLLS
SPMTRAVQTAAPLADELDMPIELETQAHEVGGIFQSVQGEPGSFQGASRAELADISDRLI
FNEDIHDEGWYRLGSHVETPAEGQGRGKRLYRSILERYGNQDGVVALVCHEWITNYVLRA
ALGLSDPEGEPDPWFSLPNTSSTFIQTGLPLPGPYEGGGTAMIWWVGRFDHLPDEQVSR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcttctcattcgtcatggccagtccgcaaacaacgcactcagcggagcaaac
cacccggtgagcagccaatatcccgatcccacgttgaccgacttgggccgtcagcaggcc
gagacgctggcgcatgccttcaccgacgggctgctgccacgtcccagcgtgttgctcagc
tccccgatgacccgcgccgtgcagacggccgcgccgcttgccgacgagctcgacatgccg
atcgagttggagacgcaggcccacgaggtgggtggcatcttccagagcgtgcagggcgag
cccggtagcttccagggggcgtcgcgcgcggagctggctgacatcagtgaccggctgatc
ttcaacgaggacatccacgacgagggttggtatcgcctcggatcgcatgtggagaccccg
gccgaggggcagggacgcggcaagcgcctctatcgctcgatcctggagcggtacggcaac
caggacggcgtggtcgcgctggtctgccacgagtggatcaccaactatgtgctgcgtgcc
gcgctcggcctgtccgatcccgagggcgagcccgatccgtggttctcgctgccgaacacc
tcgagcaccttcatccagaccggccttccgttgcccggcccctacgagggtggcggcacc
gcgatgatctggtgggtcggccgcttcgaccaccttccggacgagcaagtgagccgctga

DBGET integrated database retrieval system