KEGG   Pseudomonas fluorescens SBW25: PFLU0085Help
Entry
PFLU0085          CDS       T00899                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
pfs  Pseudomonas fluorescens SBW25
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84699..86753
Genome map
AA seq 684 aa AA seqDB search
MSDDAQRWKEKYLKSIEQQEKLERRWAARLDLLRRGLVRSTLAAEGTDRAVDQCMKEMRD
VVRTDDMDAALAALLPRLEKAVLDSEQRRETRVDQISTALTSLVTQLQKLPLPREVARPL
KTFAKQLDGRVSQAREIPLLLSELSGLQGQALNNLEPDGETTRPGPGLLQRLFGSKDVAT
EPEASESTARPAPQPIVAKPVAEPQPPEQSEELTQALRAFAPPPQEKVASAVESAGPAKV
ADAVSETFVYEAPPQAEPVEASVVPVAYVERELPTEEPAPESALAAFIETPDVQVETPGE
TTIGSLSLPPVLEVEESDPDELQADGTYALPDSPEPSYSSVAKHIEDTLLGLLEELSLPE
RHRPQAEAMRERLAHGLNWYELLPILDDLAVLMLAITDSGQHEFEAYLKQLNERLEAFQG
HLQVASDGHADSRSAARELDTQIREQVDGLQSSVQEAADLESLKHVLESHLEGLLGTMDE
HQQQRDQREQETAARLKGLAERVANMEQEAQGYREHLEVQRQKALIDPLTGLPNRAAWSE
RLDHEVNAWHQRGNSLSLAMLDLDHFKRINDGYGHLAGDRVLKIIANVLRKRLRPTDFIA
RFGGEEFVLLMPDSSLADALAAVEVLRGAIEACPFHFKGEPVTITVSMGVAQFQPGERSD
LALKRADAALYRAKAAGRNQVQAA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgcccagcgctggaaagagaaatacctcaaaagcatagagcaacaagaa
aagctcgaacgccgttgggcagcccgcctcgacctgctacgccgtgggctggtgcgcagc
acgctggccgctgaaggcaccgaccgtgccgtcgaccagtgcatgaaggaaatgcgtgac
gttgtccgtacagatgatatggacgccgccctcgccgccttgctgccgcgcctggaaaaa
gccgtgctggattcggagcagcgccgtgaaactcgggtcgaccagatcagcaccgcgctg
acgtccctggttacccagctgcaaaagttgccattaccgcgtgaggttgcccggccgctt
aagacgttcgccaagcagttggacggccgagtcagccaggcacgtgagatccccttgctg
ctcagcgagttgagtggcctgcagggccaggcgctgaacaacctggagccggacggcgaa
accacacgcccagggccggggcttttgcagcgcctgtttggttccaaagacgtcgcgacc
gagccggaggccagcgaatcgacagcccgcccggcaccgcaacccattgtggccaagcct
gtcgccgagccccagccgcccgaacagtccgaggaactgacgcaagccttgcgcgccttt
gcgccgccgcctcaggaaaaggttgcctccgcagttgagtcggccgggccggccaaggtg
gcggacgctgtcagtgaaacgtttgtatacgaggctccgcctcaagctgagcccgttgaa
gcgtccgtagtacccgtagcgtatgtcgagcgggagcttccgacagaagagccggcaccg
gaaagcgccctcgccgcttttatcgaaacgcctgacgttcaggtcgaaacgccgggtgag
accaccatcggcagcctgtcgctccctcctgtgctggaggtcgaggagtccgatcccgac
gagctgcaagcggacggcacctatgccttacctgattcgccggagccgtcctacagctcc
gtagccaagcatattgaagacactctgctcgggctgctggaggagttgtcgctacccgag
cgtcaccggccccaggccgaagccatgcgtgagcgtctggcgcacggcctgaactggtac
gaactgctaccgatcctcgacgatctggccgtcttgatgctggcaatcaccgacagcggc
cagcacgaattcgaggcttacctcaagcagctcaacgagcgtctcgaagcgttccagggg
catttgcaggtcgccagcgacggccatgccgatagccgttcggccgcccgtgagctggac
acgcagatccgcgaacaggtcgatggcttgcaaagcagcgtgcaggaggccgccgatctg
gaaagcctcaagcacgtattggaaagccacctcgaaggtcttctcggcaccatggacgag
caccagcagcagcgtgaccagcgcgagcaggaaacggcagcgcgactgaaaggcttggcc
gagcgggttgccaatatggagcaggaagcccagggctatcgcgagcacttggaggtgcag
cgccagaaggccttgatcgatccgctcactggcctgcccaaccgcgccgcgtggagtgag
cggctcgatcacgaggtcaacgcctggcatcaacggggcaacagcctgtcgctggcgatg
ctggacttggatcacttcaagcgcatcaacgacggctacggccacctggctggcgacagg
gtgctgaagatcatcgccaacgtactgcgcaagcgcctgcggccgaccgactttatcgcg
cgtttcggcggtgaggagttcgtgttgctgatgcccgactcatccctcgcggatgccctg
gcggcggttgaagtgttgcgcggcgcgattgaagcctgcccgtttcacttcaagggggag
ccggtaacgatcactgtgtccatgggtgtggcgcagttccagccgggagagcgcagtgac
ctggcgctcaagcgcgcggatgcggccttgtaccgggccaaggccgcaggccgaaaccaa
gtgcaggccgcctaa

DBGET integrated database retrieval system