KEGG   Pseudomonas fluorescens SBW25: PFLU0247Help
Entry
PFLU0247          CDS       T00899                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PFLU0247 (dcyD)
Enzymes [BR:pfs01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     PFLU0247 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(269746..270741)
Genome map
AA seq 331 aa AA seqDB search
MIKQQLDRFNRLDLLGGATALEKLERLSTWLGRDIYVKRDDTTPLAMGGNKLRKLEYLAA
DAIAQGADTLVTAGAIQSNHVRQTAALAAKLGLGCVALLENPTGTEDPSYLGNGNRLLLD
LFDAKVELVENLDNVDDQLNALADRLRSNGKKPYLVPIGGSNALGALGYVRAGLELAGQI
QDSGIDFAAVVLASGSAGTHSGLALALSEVLPNLPVMGVTVSRTDEAQRPKVQGLAERTA
ELLGVAIPDAFKVILWDEYFGPRYGEPNAGTLSAVKLLASQEGLLLDPVYTGKAMAGLLD
GIGRQRFEDGPIIFLHTGGAPALFAYDSVFN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacaacagctcgaccgttttaatcgcctggacctgctgggcggcgccactgcc
ctggaaaaactcgagcggctgtcgacttggctgggccgggacatctacgtcaaacgcgac
gacaccacgccgctggccatgggcggtaacaagctgcgcaaactcgaatacctcgccgcc
gatgccatcgcccagggcgccgacaccctggtgaccgccggcgccatccagtccaaccat
gtgcgccagacggctgcgctggctgccaagcttggcctgggctgtgtcgccctgctggaa
aaccccaccggcaccgaagaccctagctacctgggcaacggcaaccgcctgctgctggac
ctgttcgacgccaaggtagaattggtggagaacctcgacaacgtcgacgaccagctcaac
gccctcgccgaccgtctgcgcagcaacggcaagaagccgtacctggtgcccatcggcggc
tccaatgccctcggcgccctgggttatgtgcgcgccggcctggagctggccggacagatc
caagacagcggcatcgactttgccgccgtggtgctggcgtccggcagtgccgggactcac
agtggcctggccctggccttgagcgaagtgctgccgaacctgccggtgatgggcgtcacc
gtgtcgcgtaccgacgaagcccagcgcccgaaagtgcagggcctggccgaacgcaccgcc
gagttgctgggcgtggcgatccccgacgccttcaaggtgatcctgtgggacgaatatttc
ggcccgcgttatggcgaaccgaacgccggcaccctttcggcggtcaagctattggcaagc
caggaaggcctgctgctggacccggtctacactggcaaggccatggccggcttgctggac
ggtatcgggcgtcagcggttcgaggatggcccgattattttcctgcacaccggtggggcc
ccggcattgtttgcctatgactcggttttcaactga

DBGET integrated database retrieval system