KEGG   Pseudomonas fluorescens SBW25: PFLU0284Help
Entry
PFLU0284          CDS       T00899                                 

Definition
sulfur metabolism-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pfs00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
308454..309290
Genome map
AA seq 278 aa AA seqDB search
MSELFLGHPFIAPVIELARQAGEVILPYWRADVAVTSKADDSPVTAADLAAHHLILAGLT
ALDPSIPVLSEEDADIDQSVRAGWQRWWLVDPLDGTKEFIAGSEEFTVNIALIEQGRVIF
GVVSMPTSGRCYFGGAGLGAWRSDVNEAPKQIQVREAPAAGESFTVVASRRHTSPEQERL
LDGLSEGLGALKLANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVLEGAGGEVLE
LSGEPFSYPARASLLNPFFLALPAKAAWRERLLTLARS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgtttttaggtcacccgtttattgcccctgtgatcgaactggcccgccag
gccggtgaagtgatattgccgtactggcgcgccgacgtggccgtcacctccaaggctgac
gattcgcccgtgacggcagcggacttggccgctcaccatctgattctcgccggcctcacc
gcgctggacccaagcatccccgtgctgtccgaggaggatgccgatatcgaccaaagcgtg
cgtgccggctggcagcgctggtggttggtggacccgttggatggcacgaaggagttcatc
gctggcagtgaagagttcaccgtcaacatcgccttgatcgaacaaggccgggtgatattt
ggcgtggtgtcgatgcccaccagtggccgttgctacttcggtggcgcgggcctgggcgcc
tggcgctcggatgtgaatgaagcgcccaagcagattcaagttcgcgaggcgccggcggcg
ggcgagtcgtttacggtggtggccagtcgtcggcacaccagccccgagcaggaacgcttg
ttggacggtttgagcgaaggcctgggcgcactgaagctggcgaatataggcagttcgttg
aagttttgcttgttggccgagggcagcgcggattgctacccgcgcctggcgccgacgtcg
cagtgggacaccgcagccgcccaaggcgtgctggaaggcgcgggcggtgaggtgttggag
ttgagcggtgaaccgttcagttatccggcgcgggcatcgttgttgaacccgttcttcctg
gcgttgccggcgaaggcagcatggcgtgagcggttgctcaccctggccaggtcgtaa

DBGET integrated database retrieval system