KEGG   Pseudomonas fluorescens SBW25: PFLU0284Help
Entry
PFLU0284          CDS       T00899                                 

Definition
sulfur metabolism-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PFLU0284
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PFLU0284
Transfer RNA biogenesis [BR:pfs03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PFLU0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
308454..309290
Genome map
AA seq 278 aa AA seqDB search
MSELFLGHPFIAPVIELARQAGEVILPYWRADVAVTSKADDSPVTAADLAAHHLILAGLT
ALDPSIPVLSEEDADIDQSVRAGWQRWWLVDPLDGTKEFIAGSEEFTVNIALIEQGRVIF
GVVSMPTSGRCYFGGAGLGAWRSDVNEAPKQIQVREAPAAGESFTVVASRRHTSPEQERL
LDGLSEGLGALKLANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVLEGAGGEVLE
LSGEPFSYPARASLLNPFFLALPAKAAWRERLLTLARS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgtttttaggtcacccgtttattgcccctgtgatcgaactggcccgccag
gccggtgaagtgatattgccgtactggcgcgccgacgtggccgtcacctccaaggctgac
gattcgcccgtgacggcagcggacttggccgctcaccatctgattctcgccggcctcacc
gcgctggacccaagcatccccgtgctgtccgaggaggatgccgatatcgaccaaagcgtg
cgtgccggctggcagcgctggtggttggtggacccgttggatggcacgaaggagttcatc
gctggcagtgaagagttcaccgtcaacatcgccttgatcgaacaaggccgggtgatattt
ggcgtggtgtcgatgcccaccagtggccgttgctacttcggtggcgcgggcctgggcgcc
tggcgctcggatgtgaatgaagcgcccaagcagattcaagttcgcgaggcgccggcggcg
ggcgagtcgtttacggtggtggccagtcgtcggcacaccagccccgagcaggaacgcttg
ttggacggtttgagcgaaggcctgggcgcactgaagctggcgaatataggcagttcgttg
aagttttgcttgttggccgagggcagcgcggattgctacccgcgcctggcgccgacgtcg
cagtgggacaccgcagccgcccaaggcgtgctggaaggcgcgggcggtgaggtgttggag
ttgagcggtgaaccgttcagttatccggcgcgggcatcgttgttgaacccgttcttcctg
gcgttgccggcgaaggcagcatggcgtgagcggttgctcaccctggccaggtcgtaa

DBGET integrated database retrieval system