KEGG   Pseudomonas fluorescens SBW25: PFLU0303Help
Entry
PFLU0303          CDS       T00899                                 

Gene name
wssD
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pfs00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332766..333962
Genome map
AA seq 398 aa AA seqDB search
MSPLKCMALAALGAVMFVGSAQAQTCDWPLWQNYAKRFVQDDGRVLNSSMKPTESSSEGQ
SYAMFFALVGNDRASFDKLWTWTKANMSGADIGQNLPGWLWGKKADNTWGVIDPNSASDA
DLWMAYALLEAARVWNAPQYRADAQLLLANVERNLIVRVPGLGKMLLPGPVGYVHAGGLW
RFNPSYQVLAQLRRFHKERPNAGWNEVADSNAKMLADTASNPHGLAANWVGYRATSANTG
LFVVDPFSDDLGSYDAIRTYMWAGMTAKGDPLAAPMLKSLGGMTRATAASATGYPPEKIH
VLTGEVEKNNGYTPMGFSASTVAFFQARGETALAQLQKAKVDDALAKALAPSAPDTAQPI
YYDYMLSLFSQGFADQKYRFEQDGTVKLSWEAACAVTR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcttaagtgcatggccctggcggcgctgggcgctgtgatgttcgtcggtagc
gcgcaagcgcaaacctgcgactggccgttgtggcagaactacgccaagcgcttcgtgcag
gatgatgggcgcgtgctgaactcgtccatgaaacccaccgagagcagctcggaaggccaa
tcctatgcgatgttctttgccctggtcggcaacgaccgtgctagcttcgacaagctgtgg
acctggaccaaggccaacatgtcgggcgccgacatcggccagaacctgcccggctggttg
tggggcaaaaaagccgataacacgtggggtgtgatcgacccgaactccgccagcgacgcc
gacttgtggatggcctacgccttgctcgaagcggcacgcgtgtggaatgcaccgcagtac
cgtgccgacgcgcaattgttgctggcaaacgttgaacgcaacctgatcgtgcgtgtgcct
ggcctcggcaagatgctgttgccaggcccggtgggctacgtgcacgccggtggcctgtgg
cgcttcaacccgagctatcaggtgctggcgcaactgcgtcgcttccacaaagaacgcccg
aatgccggctggaatgaggtggccgacagcaacgccaagatgcttgccgatacggccagc
aaccctcacggcctcgcggccaactgggtcggttaccgcgccaccagcgccaacaccggg
ctgttcgtggtcgacccgttttccgatgacttgggcagctatgacgcgatccgcacttac
atgtgggccggcatgaccgccaagggcgatccgctggcggcgcccatgttgaaatccctg
ggcggcatgacgcgggccaccgcagcatcggccaccggctacccaccggaaaaaatccat
gtactgaccggcgaagtcgagaaaaacaacggctatacgccgatgggcttctcggcctcc
accgttgccttcttccaggctcgcggcgaaaccgcactggcgcagttgcagaaggccaag
gtcgacgacgcgctcgccaaagccctggccccttcggcgccggacaccgcgcagccgatc
tactacgactacatgctcagcctgttcagccagggctttgccgatcagaagtaccgtttt
gaacaagacggtacggtcaaactttcctgggaggccgcatgcgccgtcacacgctag

DBGET integrated database retrieval system