KEGG   Pseudomonas fluorescens SBW25: PFLU0807Help
Entry
PFLU0807          CDS       T00899                                 

Definition
putative exported alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfs00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pfs00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
910775..912316
Genome map
AA seq 513 aa AA seqDB search
MSHFDLGRRRVMQAVGAGLLLPGLAPAVIASVKDRPQLTDGVQSGDLLGDRAMIWSRSDR
PARMVVEWDTRSVFSNPRRFVSPLADNRTDFTARVELTGLPADQAIFYRVHFEDAQTGVA
SEPWFGHLRSVPQQRRDIRFVWSGDTVGQGFGINPEIGGMRIYEAMRLRLPDFFIHSGDT
IYADGPVPAQLTTEGGRIWRNITTEAKSKVAETLDEYRGNYRYNLMDENVRRFNAEVPQI
WQWDDHEVVNNWSPSKQLDERYQTKDINTLVGRARQAWLEYSPMRRQSADAGGRIYRKLS
YGPLLEVFVLDMRSYRGPNDDNLGAEKPFLGREQLDWLKRELKASQAQWKVIAADMPIGL
GVPDGEVSPGVARWEAIANNDPGAPQGREVEIAELLGFLRAQQVRNHVWLTADVHYCAAH
HYHPDRAAFQDFEPFWEFVAGPLNAGSFGPNPLDKTFGPEVVFEKAPPAQNTSPFAGFQF
FGEVQIDGQTAELTVILRDLDGVSVFEQKLQPA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagccacttcgatctcggccgtcgccgtgtgatgcaagccgtcggcgccggtctgttg
ttgccgggtttggccccggcagtgatcgcttcggtaaaggatcgcccgcaactcaccgac
ggcgtacagtccggcgacctgctcggcgatcgcgccatgatctggagccgcagcgatcgc
ccggcccgcatggtagtggagtgggacacccgcagcgtcttcagcaacccgcgtcgattc
gtctcgcccctggccgacaatcgcaccgacttcaccgcccgtgttgaactcaccggattg
cccgccgaccaggcgattttctaccgcgtgcattttgaagacgcccagaccggcgtcgcc
agcgaaccctggttcggccacctgcgcagcgtgccgcaacaacgccgcgacatccgtttt
gtgtggagcggcgacaccgttggccagggcttcggtatcaatccggagattggcggcatg
cgcatctacgaagccatgcgcctgcgcctgccggacttctttatccacagcggcgacacc
atctacgccgacggcccggtgccggcgcagctgaccaccgaaggcggtcgcatctggcgc
aatatcaccaccgaggccaagagcaaagtcgctgaaaccctggatgaatatcgcggcaat
taccgctacaacctgatggatgaaaacgtgcgccgcttcaacgccgaggtgccgcagatc
tggcagtgggacgaccacgaagtggtgaacaactggtcgccaagcaagcagttggatgag
cgttaccagaccaaggacatcaacaccttggtggggcgtgcgcgccaggcctggctggag
tattcaccgatgcgccggcagagcgcggatgcgggcgggcggatttatcgcaagctcagc
tatggcccgctgctggaggtgttcgtgctggatatgcgcagttatcgcggacccaacgat
gacaacctgggcgctgaaaagcccttcctcggccgcgaacaactggactggctcaagcgc
gaactcaaggcgtcccaggcgcagtggaaagtgatcgccgccgacatgcccatcggcctc
ggtgtgcctgatggtgaggtcagccccggtgtggcgcgttgggaggccatcgccaacaac
gaccccggtgcgccgcaaggtcgcgaagtggaaatcgccgagttgctgggctttttaagg
gcgcaacaggtgcgcaaccatgtgtggctgacggccgatgtgcattactgcgccgcgcat
cactatcacccggaccgtgcggcgttccaggatttcgaaccgttctgggagtttgtcgcc
gggccgttgaatgctgggagcttcgggcccaatccgctggataagacctttggccccgag
gtggtgttcgagaaggcaccgccggcgcagaacacctcgccgttcgcgggttttcagttt
tttggcgaggtgcagattgatgggcagacggcggagttgacggtgatcctgcgggatttg
gatggcgtctcggtattcgaacaaaaactccaaccggcctga

DBGET integrated database retrieval system