KEGG   Pseudomonas fluorescens SBW25: PFLU0942Help
Entry
PFLU0942          CDS       T00899                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pfs00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pfs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1044986..1046449
Genome map
AA seq 487 aa AA seqDB search
MSLSLNKIFAHAGRDLLIRELTLDSRNVRAGDLFLAVPGGKYDGRAHIADALQRGAAAVA
YEVEGATVLPITDVPLIPVKGLAKQLSDIAGRFYGDPSRHLNLVGVTGTNGKTSVTQLVA
QALDLLGQHCGIVGTLGAGFYGALQSGLHTTPNPIAVQATLADLKKAGAKAVAMEVSSHG
LDQGRVTALAFDVAVMTNLSRDHLDYHGTMEAYAAAKAKLFAWNDLKCRVVNLDDAFGRQ
LAAEDSEARLISYSLEDSSAYLFCREAQFNDEGVRATLVTPQGEHHLRSTLLGRFNLSNV
LAAIGALLGLDYALDEILRVLPKLEGPAGRMQRLGGGKQPLVVVDYAHTPDALEKVLEAL
RPHAKGKLLCLFGCGGDRDRGKRPLMAEIVERLADGVLVTDDNPRSEDPSQIFDDIRAGF
NDVSKAAFVAGRGAAIAQLIASASADDVVVLAGKGHEDYQEINGERHAFSDLVEADHALT
AWEVAHA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttagcctgaacaagatttttgcccacgccggtcgtgatctgttgattcgcgag
ttgacgctggacagccgtaatgtacgcgccggtgacctgttcctggcggtgccgggcggt
aagtacgatggccgtgcgcatatcgccgatgcgttgcagcgcggtgctgcggcagtggct
tatgaagtggaaggcgccaccgtgctgccgatcaccgatgtgccgttgattccggtcaaa
gggttggcaaaacagttgtcggatattgccggtcgcttctatggcgacccgagccgtcac
ctcaacctggtgggcgtcaccggcaccaacggcaagaccagcgtgacccagctggtcgcg
caagcgcttgacctgttggggcagcactgcggcatcgtcggcaccttgggcgccggcttt
tatggcgcgctgcaaagcggcctgcacaccacgccgaacccgatcgccgtgcaagcgacc
ctggccgacctgaaaaaggccggtgccaaggcggtcgccatggaagtttcttcccacggc
ctggatcagggccgcgtcaccgccctggcttttgacgtggcggtgatgaccaacttgtcc
cgcgatcacctggactaccacggcaccatggaggcttacgccgccgccaaggccaagctg
tttgcctggaatgacctgaagtgccgggtggtcaacctggatgacgcattcggccgccaa
ctggccgccgaagacagcgaagcgcgcctgatcagctacagcctggaagattccagcgcg
tacctgttctgccgcgaagcccaatttaatgacgaaggcgtgcgcgccacgttggtcacg
cctcagggcgaacaccacctgcgcagcacattgctcgggcgcttcaacctgagcaacgtc
ctcgccgccatcggtgcgctgctcggcctggattacgccctggatgaaatcctgcgcgtg
ctgcccaagcttgagggcccggccggtcgcatgcagcgcctcggtggcggcaagcagccg
ctggtggtggtcgattacgcccacacccccgacgccctggaaaaagtcctggaagccctg
cgcccacacgccaagggcaaattgctgtgcctgttcggttgtggcggtgatcgcgatcgc
ggcaagcgtccgttgatggccgagatcgtcgagcgcttggccgatggcgtgctcgtcacc
gacgacaacccgcgcagcgaagacccgagccagattttcgacgacatccgcgcgggcttc
aacgacgtgtccaaggccgctttcgtcgccggtcgcggtgcggccatcgcccaattgatc
gccagcgccagcgctgacgatgtggtggtactggccggtaaaggtcacgaggactatcag
gaaatcaacggcgaacgccatgccttctccgatctggtcgaggccgatcacgccttgacg
gcctgggaggtcgcccatgcttaa

DBGET integrated database retrieval system