KEGG   Pseudomonas fluorescens SBW25: PFLU1054Help
Entry
PFLU1054          CDS       T00899                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PFLU1054
   00240 Pyrimidine metabolism
    PFLU1054
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PFLU1054
   03430 Mismatch repair
    PFLU1054
   03440 Homologous recombination
    PFLU1054
Enzymes [BR:pfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PFLU1054
DNA replication proteins [BR:pfs03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PFLU1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1165750..1166178)
Genome map
AA seq 142 aa AA seqDB search
MTQVDFYILPSADPLARLDFACKLTEKAWRMGHRIYLHCSDAAQRDELDARLWRFKGESF
VPHGPAESEPEGLVVLGLGDSCGDHHDLLVNLDLKVPPFAKAFARVAEVVVEDPAIRQAA
RESFRFYREQGYPLQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagtcgacttctatatattgcccagcgccgacccgctcgcgcgcctggacttt
gcctgcaaactcaccgaaaaagcctggcgcatgggccaccgcatctacctgcattgcagc
gatgccgcccagcgcgacgagctggatgcccgcctgtggcgtttcaagggcgaaagcttc
gtgccccacggccccgccgagtctgaacctgaaggcctggtagtgctgggtttaggcgac
agttgcggcgatcaccacgacctgctggtcaacctggacctgaaagtgccgccgttcgcc
aaggcattcgcccgtgtggcggaagtggtggtggaggatccggctattcgtcaggccgcg
cgggagagtttccgtttctaccgcgaacagggctatcctctgcaggatcaccggctacaa
cgactttga

DBGET integrated database retrieval system