KEGG   Pseudomonas fluorescens SBW25: PFLU1113Help
Entry
PFLU1113          CDS       T00899                                 

Definition
putative cytochrome C551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pfs  Pseudomonas fluorescens SBW25
Brite
Enzymes [BR:pfs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PFLU1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1241935..1242903)
Genome map
AA seq 322 aa AA seqDB search
MSAVSTTRIGLMFTCWLVTAAPLMAAPLDEPLKPLPAAPTLDPAKVELGRQLFNEPRLSA
NNTLSCASCHRLDSGGADDKPFSIGFDGHPVEINTPTVFNASQNFKQFWNGRVDTLEAQI
EQVVISPVEMGSDWKTVVQNLSALPAYQAAFSQSYSDGVTAANVQNALATYERTLLTPNS
RFDRYLLGNTDILTIQEKYGYQRFKDYGCIACHQGINIGGNMFQKFGVMGDYFKARGNPV
ESDLGRYLLTQDEEDRHVFKVPSLRNVAVTAPYFHDASARTLEEAVDVMFTYQLGRTPSA
EDKALIVQFLKTLTGEWAGKPL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcagtctcaactactcgaattggcctgatgttcacgtgttggctggtcacggca
gcgcccttgatggccgccccgttggacgagccgctcaagccgttgccggcggcgccgacc
ctggacccggctaaagtcgaactgggccgccagctgttcaacgagccgcggctgtcggcc
aataacaccttgtcctgcgccagttgccatcgactggacagcggcggtgccgatgacaaa
ccgttctccattggcttcgatggccacccggtggagatcaacacgcccacggtgtttaac
gccagccagaatttcaagcagttctggaacggccgggtggacacgctggaagcgcagatc
gaacaagtggtcatcagcccggtggagatgggcagcgactggaaaaccgtggtgcagaac
ctgtccgccctgcccgcctaccaggccgccttcagccagtcgtactccgacggcgtcacc
gccgccaacgtgcaaaatgcgctggccacttatgagcgaacgctgctgacccccaactcg
cggttcgaccggtacctgttgggcaataccgatatcctcacgatccaggaaaagtacggc
taccagcgcttcaaggattacggctgtatcgcctgccaccagggcatcaatatcggcggc
aatatgttccagaagttcggcgtgatgggggactacttcaaggcgcgcggcaacccggtc
gaatcggacctggggcgctacctgctgacccaggacgaggaagatcgccatgtgttcaaa
gtgcccagcttgcgcaacgtggcggtcaccgcgccgtattttcacgatgcgtcggccagg
acactggaagaagcggtggatgtgatgttcacctaccaactgggccgcacgccctccgcc
gaagacaaggcgctgatcgtgcagtttctcaagaccctgaccggcgaatgggcaggcaag
ccgctatga

DBGET integrated database retrieval system