KEGG   Pseudomonas fluorescens SBW25: PFLU1129Help
Entry
PFLU1129          CDS       T00899                                 

Definition
putative lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Brite
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     PFLU1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1261732..1262631
Genome map
AA seq 299 aa AA seqDB search
MNMAEIDLGEGDAGFVLGEGPVGILLIHGLTGTPTELRQVAKGLAKAGNCTVYVPTLAGH
CGDNSDLQATGWRDWYEGVRKTFVGVKQRHEQVFVGGLSMGAVMSMYLASEHPGQVAGLL
MYSTTLKYDGWSINKMAFITPLLIRIPFGVRLFRFTEKPPYGIKNERLRAIVERQMKEGE
SSEAGLLTMEGVTVRELHWMNAVVKKRMPSINVPALVLHSIEDDITSRWNADYVERHLGG
PVTKILLDNCYHMITVDLQYRRVIELSAAFISERTLCSERACPALGGEAAPFPALSFSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatggcagagatcgacctcggtgaaggtgatgccggcttcgttctcggtgaaggt
ccggtcgggatcctgttgatccacggcctgaccggcactcccacggaattgcgccaggtc
gccaagggcctggccaaggcgggcaactgcacggtgtacgtgcctaccctggccgggcat
tgcggcgacaacagcgacttgcaagccaccggttggcgtgactggtacgaaggcgtgcgc
aagaccttcgtgggcgtgaagcagcgccacgagcaggtgtttgtcggtggcttgtcgatg
ggtgcggtgatgtcgatgtacttggcgtcggagcatccgggccaggtggccgggttgctg
atgtattccaccacgctcaagtacgacggttggagcatcaacaaaatggcgttcatcacg
ccgttgctgatccgtatcccgttcggcgtgcgcctgttccgctttaccgagaagccgccc
tacggcatcaagaatgaacgcctgcgggccatcgttgaacggcagatgaaggaaggcgaa
agcagcgaggcgggcctgttgacgatggagggcgtgacggtgcgtgaattgcactggatg
aacgccgtggtcaaaaaacgcatgccgtcgatcaacgtaccggcgctggtgctgcactcc
atcgaggacgacatcaccagccgctggaacgccgattacgtggagcgccatcttggcggg
ccggtgaccaagatcctgttggacaactgctaccacatgatcaccgtcgacctgcaatac
cgccgagtgatcgagctaagcgccgctttcatcagcgaacgaactctatgtagtgagcgg
gcttgccccgcgctgggtggcgaagccgccccatttccggcactgagtttttccagttaa

DBGET integrated database retrieval system