KEGG   Pseudomonas fluorescens SBW25: PFLU1699Help
Entry
PFLU1699          CDS       T00899                                 

Definition
putative acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pfs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1869716..1870321
Genome map
AA seq 201 aa AA seqDB search
MRMWFLSAGLALMCMAQNAAAGTVLIVGDSISAGFGLDTRKGWVALLEQRLKQEGFDDKV
VNASISGDTSAGGLARLPAALAEHKPDVVVIELGGNDGLRGQPPAQLKQNLASMIDQSKA
GGAKVLLLGMQLPPNYGPRYTTAFAEVYGVLAKEKNVPLVPFFLDGVGGHPELMQADQLH
PAVGAQGKLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgtggtttttgagtgctggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagtgccggtttcggcctggatacccgc
aaagggtgggtggcactgctggagcaacggctcaagcaggagggtttcgacgataaagtg
gtcaacgcctccatcagtggtgacaccagtgccggaggcctggcgcggctgccggcggcg
cttgcagagcataagcctgacgtggtggtgatcgagttgggcggcaatgatggcttgcgc
gggcaaccgccggcgcaattgaaacaaaatcttgcatcgatgattgaccagtccaaggcc
ggcggtgccaaggtgttgttgctgggtatgcagctgccgcccaactatggcccgcgatac
accaccgcatttgccgaagtctatggtgtgttggccaaggaaaaaaacgtcccgctggta
ccgtttttcctcgatggcgtgggcggtcatccggagctgatgcaggcggatcaactgcac
ccggcggtcggtgcccagggcaagttgctggaaaatgtctggccgacgctaaaaccactg
ttatga

DBGET integrated database retrieval system