KEGG   Pseudomonas fluorescens SBW25: PFLU1699Help
Entry
PFLU1699          CDS       T00899                                 

Definition
putative acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PFLU1699
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PFLU1699
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PFLU1699
Lipid biosynthesis proteins [BR:pfs01004]
 Fatty acid synthase
  Component type
   PFLU1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1869716..1870321
Genome map
AA seq 201 aa AA seqDB search
MRMWFLSAGLALMCMAQNAAAGTVLIVGDSISAGFGLDTRKGWVALLEQRLKQEGFDDKV
VNASISGDTSAGGLARLPAALAEHKPDVVVIELGGNDGLRGQPPAQLKQNLASMIDQSKA
GGAKVLLLGMQLPPNYGPRYTTAFAEVYGVLAKEKNVPLVPFFLDGVGGHPELMQADQLH
PAVGAQGKLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgtggtttttgagtgctggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagtgccggtttcggcctggatacccgc
aaagggtgggtggcactgctggagcaacggctcaagcaggagggtttcgacgataaagtg
gtcaacgcctccatcagtggtgacaccagtgccggaggcctggcgcggctgccggcggcg
cttgcagagcataagcctgacgtggtggtgatcgagttgggcggcaatgatggcttgcgc
gggcaaccgccggcgcaattgaaacaaaatcttgcatcgatgattgaccagtccaaggcc
ggcggtgccaaggtgttgttgctgggtatgcagctgccgcccaactatggcccgcgatac
accaccgcatttgccgaagtctatggtgtgttggccaaggaaaaaaacgtcccgctggta
ccgtttttcctcgatggcgtgggcggtcatccggagctgatgcaggcggatcaactgcac
ccggcggtcggtgcccagggcaagttgctggaaaatgtctggccgacgctaaaaccactg
ttatga

DBGET integrated database retrieval system