KEGG   Pseudomonas fluorescens SBW25: PFLU1817Help
Entry
PFLU1817          CDS       T00899                                 

Definition
putative succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFLU1817
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFLU1817
   00650 Butanoate metabolism
    PFLU1817
  Energy metabolism
   00190 Oxidative phosphorylation
    PFLU1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981173..1981541
Genome map
AA seq 122 aa AA seqDB search
MVTSVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYLVANPGIGYEQWHGLFSHNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagcgttacgaacctttcgcgttcgggcctctatgactggatggcacagcgt
gtgtctgcggtcgttctcgcggcttatttcattttcctgatcggatacctcgtcgcaaac
ccgggcatcggctatgagcaatggcacggcctgttttcccacaatgcgatgcgaatcttc
agtctgctggcccttgttgccctgggcgcacacgcctgggttggcatgtggaccatcgcg
accgactacctgacgccgatggcgctgggcaagtccgcgactgcagtacgttttctcttc
caggcagtctgcggcgtcgcgatgttcgcttacttcgtctggggtgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system