KEGG   Pseudomonas fluorescens SBW25: PFLU1821Help
Entry
PFLU1821          CDS       T00899                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFLU1821 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFLU1821 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PFLU1821 (sucB)
Enzymes [BR:pfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PFLU1821 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1987171..1988397
Genome map
AA seq 408 aa AA seqDB search
MAIEIKAPSFPESVADGTVATWHKKPGEAVKRDDLIVDIETDKVVLEVLAEADGVLGAIV
AEEGATVLSNQVLGSIEEGGAAAAAPAAAAAPAAASAPAAAPAAGAEDPIAAPAARQLAD
ENGINLASIKGTGKDGRVTKEDVVAAVEAKKNAPAAAPAKAAAPAAAAPVFAAGDRTEKR
VPMTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSF
FVKAATEALKRFPAVNASIDGGDIVYHGYADVGVAVSSDRGLVVPVLRNAELMSLAEIEG
GIAGFGKKARDGKLTIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMA
INGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccgtcattcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaaaccaggtgaggccgtcaagcgtgacgacctgatcgttgacatcgag
actgacaaggtcgtgctggaagtgctggctgaggctgacggcgtgctgggcgcaatcgtt
gccgaagaaggcgctaccgttctgtcgaaccaggtactgggttcgatcgaagagggcggc
gctgctgctgccgctcctgccgccgccgctgcaccggctgctgcttcggcgcctgctgcc
gctccggctgctggcgctgaagacccaatcgctgcaccggctgcccgtcagctggctgac
gagaacggcatcaacctggcgtccatcaagggcaccggcaaagacggccgcgtgaccaag
gaagacgtggttgccgctgttgaagccaagaaaaacgctcccgctgccgcacctgccaag
gctgctgccccggctgccgctgcacctgtgttcgctgccggcgaccgcaccgagaagcgc
gttccgatgacccgcgtacgtgccaccgtggccaagcgcctggttgaagcacagtcgaac
atggcgatgctgaccacgttcaacgaagtcgacatgactgaagtcatggccctgcgttcg
aagtacaaggacctgttcgagaagtcccacaacggcgtacgcctgggcttcatgtcgttc
ttcgtgaaagcggccaccgaagcgctgaaacgcttcccggcggtcaacgcttccatcgac
ggcggcgacatcgtttaccatggctacgcagacgtcggcgttgccgtctccagcgaccgt
ggcctggtggtaccggtcctgcgtaacgccgaactgatgagcctggctgaaatcgaaggc
ggcatcgccggcttcggcaagaaagcccgtgacggcaagctgaccatcgacgagatgacc
ggcggtaccttcacgatcactaacggtggtaccttcggttcgatgatgtcgaccccgatc
gtcaacccgccacaagccgcgatcctgggcatgcacaacatcatccagcgtccgatggcc
atcaacggccaagtcgtgatccgcccaatgatgtacctggcactgtcttacgatcaccgc
ctgatcgatggtaaagaagccgtgactttcctggtgaccatcaagaacctgctggaagac
ccggctcgtctgctgctggacatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system