KEGG   Pseudomonas fluorescens SBW25: PFLU2009Help
Entry
PFLU2009          CDS       T00899                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFLU2009
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFLU2009
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PFLU2009
Enzymes [BR:pfs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PFLU2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2177585..2178961
Genome map
AA seq 458 aa AA seqDB search
MQYVSSRNSATKADFETVVLSGVAEDGGLYMPSAPPEFSAQEIANWSMLTYDELAFRVIK
PFVGQTIPEEDLKQLLKDAYSEFDHRTIAPLQQVDRNEWVLELFHGPTRSSKDFSAQLQV
RFVEYFLAKRKRRALIVGATNGDTGLAAIEAFKNSQSSVVVAFFPESGSPDEQIMRLHAS
DHPNLYRFAVNGSFDDCQMIVSKLFRNWQSNYTAVSFNSSNWVNVMAQLVFYFYATLQLS
GGQRTIGFSVPASSFSEVYAGYIAQKMGLPITQMIVATNRNDALHQLFLKNHYSRIKSDR
SLSPAMDLSVFSNLERLLWELYGKDSVAVSKLMEEFEENGEMVIDNKLWLQARMIIDSYS
VSDEETLAEIKSMHHDTGYIIDPHTATGVLAARLYRRSMVAPMVTLGEVSPIKSAILLAK
LGIVPIPKVTPVQSSCSLRLYRINPDDVGTINQVLSSI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacgtaagtagccgcaattctgctaccaaggctgactttgaaacggttgtacta
tctggagtcgctgaggatggtggattgtatatgccaagtgctccaccggagtttagtgct
caggagatagcgaattggtcgatgctcacctatgacgaactggcttttcgagttataaag
ccattcgttggtcagacgatcccagaagaggatctaaagcagcttcttaaagatgcttat
agtgaattcgatcatcgcactattgcgcccttacaacaggtcgataggaatgaatgggta
cttgagttgtttcacgggccgactcgctcttcgaaagatttttcagcccagttgcaagtc
cgttttgtggagtacttccttgcaaaacggaagcgccgggcactgattgtaggggcgacg
aatggagacactggacttgccgccattgaagcttttaagaatagtcaaagttcggttgtt
gttgcattttttccagaatcgggttctccagatgagcagattatgcgattgcatgcgtca
gaccatcctaacctttatcgcttcgcagtaaatgggagctttgatgactgtcaaatgatt
gtctcgaaactgtttagaaattggcagtcaaattacacggcagttagctttaattcgagt
aattgggttaatgtcatggcgcagttggttttctacttctatgccacacttcaactcagt
ggggggcaaagaactattgggttcagtgttccggcatcaagcttttctgaagtttatgca
gggtacattgcgcagaaaatggggttgccgatcactcaaatgattgttgctaccaatcgt
aatgatgctttgcatcaattgtttttgaaaaatcattattccagaatcaagtctgatagg
agtttatctcctgcaatggatctttcggttttttcaaatctggaacgattactatgggag
ctctatggtaaggattccgttgctgtgagtaagctgatggaggagtttgaggaaaacgga
gaaatggtcatagacaataagctatggctgcaagcacgaatgattattgactcttactcc
gtaagcgatgaagaaaccttagcggagataaagagcatgcatcacgatactggctatata
attgacccgcacacggcgacgggggtgctcgccgctagactctatagacgcagcatggtg
gctccgatggtcactctcggggaggtttcaccaataaagtcggctatactacttgctaag
cttggcatcgtacctataccgaaggtaacgcctgtacagagtagctgctcactaagattg
tatcgaataaacccagacgacgttggcactataaatcaagtgctcagcagcatctga

DBGET integrated database retrieval system