KEGG   Pseudomonas fluorescens SBW25: PFLU2223Help
Entry
PFLU2223          CDS       T00899                                 

Definition
putative ABC transporter ATP-binding protein
Orthology
K02031  
peptide/nickel transport system ATP-binding protein
K02032  
peptide/nickel transport system ATP-binding protein
Organism
pfs  Pseudomonas fluorescens SBW25
Module
Peptides/nickel transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2410975..2412621
Genome map
AA seq 548 aa AA seqDB search
MTLLSVENLRIALPAGADRSHALYDLSLQLRSGECLCVVGESGSGKSMLAKALLRQLPTP
LSVESGRLVFRDEDLAKLSETAMRQLRGRDISMVFQEPMSALNPLLRVGEQIDETLRAHG
VKSAQERRRRVVELLGYVGLPEPERLRLVYPFELSGGQRQRVVIAMALAFDPSLLIADEP
TSALDVTTQAQIIDLLRKIQQDKGMSLLFITHDFAVVEAIADRVLVLEKGQLVEQGSAHQ
VLRKPQALYTQQLLAAVWAQPRAPRTTVDGSVVLKAEQLNKVFRSNSGWWRKRATQALAQ
VQLTLREGETLGIVGESGSGKSTLGRCLVRLLRADSGQIQWLGQDVTALSEGRLRALRSD
VQMIFQDPFASLNPRQTVGRIVMTGPLVQGHSKAEAERRTRSFLALVGLPATAFERYPHE
FSGGQRQRIGIARALAVEPKILIADECVSALDALIQVQILELLEDLQRRLKLSIVFITHD
LRVAARLCDRIAVMQGGHVVEQGEAATLLVHPQHAYTQTLLRGFSRTVLPSTVTPQNLEF
KEACPTHG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgctcagtgtggaaaacctgcgtatcgccttgccggccggtgccgaccgcagt
cacgcgctgtatgacctgtcgctgcaattgcgcagcggcgaatgcctatgtgtagtgggc
gagtccggctcgggcaagtcgatgttggccaaggcattgttgcgccagttaccgacgccg
ctgagcgtggaaagcgggcgactggtgtttcgtgatgaagacctggcgaagctcagtgaa
accgcgatgcgccagctgcgcgggcgagatataagcatggtgttccaggagcccatgagc
gcgctgaacccgctgctgcgcgtgggtgagcagatcgatgaaaccctgcgcgcccacggg
gtgaaatcggcccaggagcgtcgccgacgggttgtggagttgctgggttatgtcggcctg
cccgagcctgaacgcctgcgcctggtctatccctttgagctctccggtggccagcgtcag
cgcgtggtcatcgccatggcgttggcgttcgatccctcgttactgatcgccgacgaaccc
acctcggcgctggatgtgaccacccaggcgcagatcatcgatctgttacgcaagattcaa
caggataagggcatgtcgctgttgttcatcacccatgatttcgccgtggtcgaggccatt
gccgaccgcgtgctggtgctggaaaaaggtcaactggtggagcagggcagcgcccatcaa
gtattgcgcaagcctcaggcgctttatacccagcaactgctggcagcggtctgggcgcaa
cctcgggccccgcgcacgacggtggacgggagtgtggtgctcaaggccgagcaactcaat
aaagtgtttcgcagcaacagcggttggtggcgcaagcgtgccacccaggccctggcgcag
gttcagttgaccctgcgcgagggtgaaaccctcggcattgttggggagtcaggctcgggg
aaatccactctggggcgttgccttgttcggctgctacgtgctgacagtggtcaaattcaa
tggctgggtcaggatgtaacggcgctttccgaagggcgtttgcgagcattgcgtagcgat
gtgcagatgattttccaggacccgtttgcctcgctcaatccgcgccagaccgtcggtcgt
atcgtcatgaccggcccgctggtacaggggcactcaaaggccgaggccgagcggcgcacg
cgctcatttttggcgttggttgggctacccgccacggcgttcgagcgctatccccatgag
ttctccggtggccagcgccaacgtatcggtatcgcccgtgccttggctgtggagccgaaa
atactcatcgcggacgaatgcgtttccgctctggatgcgctgatccaggtacagattctc
gagttgcttgaagacctgcaacgtcggctcaagctgagcattgtgttcatcacccacgat
ttgcgagtggccgccagactgtgtgatcgcattgccgtgatgcagggcgggcatgtggtg
gagcagggggaagcggcaacgctactggtccatccgcaacacgcttatacccagacctta
ttgcgtggtttctccagaaccgtcctcccttcgacagtcactcctcaaaaccttgaattc
aaagaggcttgtcccactcatggctga

DBGET integrated database retrieval system