KEGG   Pseudomonas fluorescens SBW25: PFLU2301Help
Entry
PFLU2301          CDS       T00899                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PFLU2301 (xylA)
   00051 Fructose and mannose metabolism
    PFLU2301 (xylA)
Enzymes [BR:pfs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PFLU2301 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2503459..2504775)
Genome map
AA seq 438 aa AA seqDB search
MPYFPGVEKVRFEGPSSDAPLAFRHYDANKIILGKPMREHLRMAACYWHTFVWPGADMFG
VGTFKRPWQRSGDPMELAIGKADAAFEFFSKLGIDYYSFHDTDVAPEGSSLKEYRHHFAQ
MVDHLERHQEQTGIKLLWGTANCFSNPRFAAGAASNPDPEVFAYAAAQVFSAMNATLRLK
GANYVLWGGREGYETLLNTDLKREREQLGRFMRMVVEHKHKIGFKGDLLIEPKPQEPTKH
QYDYDSATVFGFLHEYGLEHEIKVNIEANHATLAGHSFHHEIATAVSLGIFGSIDANRGD
PQNGWDTDQFPNSVEEMTLATYEILKAGGFKNGGYNFDSKVRRQSLDDVDLFHGHVAAMD
VLALALERAAAMVQNDRLQQFKDQRYAGWQQPLGQAVLAGEFSLASLAEHAFAHELNPQA
VSGRQEMLEGVVNRFIYT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacttccccggtgtcgagaaggttcgctttgaaggccccagcagcgacgccccc
ctcgcctttcgccattacgacgccaacaagatcatcctcggcaaacccatgcgcgaacac
ctgcgcatggcagcctgctattggcacaccttcgtatggccgggggcggatatgttcggt
gtaggcaccttcaagcggccctggcagcgcagcggcgacccgatggaactggccatcggc
aaggccgacgcggcgttcgaatttttctccaaactgggcatcgactactacagctttcac
gacacggacgtcgcccctgaaggcagctcgctcaaggagtaccgccaccacttcgcgcag
atggtcgatcacctcgagcgccatcaggaacagaccgggatcaagctgctctggggcacc
gccaattgcttcagcaacccgcgctttgccgccggcgccgcgagtaacccggacccggag
gtgttcgcctacgccgccgcccaggtgttcagcgccatgaatgccaccctgcggctcaag
ggcgccaactatgtgctgtggggtggccgtgaaggctatgaaaccctgctcaataccgac
ctcaagcgcgaacgcgagcaactcgggcgcttcatgcgcatggtggtggagcacaagcat
aagatcggcttcaagggcgacctgctgattgagcccaagccccaggaaccgaccaagcac
caatacgattacgacagcgccacggtgttcggcttcctgcatgagtacgggctggagcat
gagatcaaggtgaacatcgaggccaaccacgccaccctggccgggcacagcttccatcac
gagatcgccacggccgtgtccctgggtatcttcggcagcatcgacgccaaccgcggcgac
ccgcagaacggctgggacaccgaccagttccccaacagcgtcgaggaaatgaccctggcc
acctatgaaatcctcaaggccggcgggttcaagaacggtggctacaatttcgactccaag
gtgcgccgccaaagcctggacgatgtggacctgttccacgggcatgtcgcggccatggat
gtgctggccctggcgctggaacgtgcggcggcgatggtgcagaacgaccgcttgcagcag
ttcaaggaccagcgttatgccgggtggcagcaaccgttgggccaggcagtgctggccgga
gagttcagcctggcatcgctggccgagcatgcgtttgcccatgaactgaacccgcaggcg
gtgagtggtcgtcaggagatgcttgaaggcgtcgtgaatcgctttatctacacctga

DBGET integrated database retrieval system