KEGG   Pseudomonas fluorescens SBW25: PFLU2375Help
Entry
PFLU2375          CDS       T00899                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFLU2375
   00052 Galactose metabolism
    PFLU2375
Enzymes [BR:pfs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PFLU2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2588531..2589679)
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLAMSLLIASGGAQAAGLTSEHKPFGKTNDGTAVEQYILRNSHGMQATVIT
YGGVLQSLKVPDKNGKVDDVVLGFDDVQGYQAGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKHVWKASPVKSKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDKNELHIDYKATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGELAPVKGTPMDFLKPTPIGQHIKEDHPQLKFAEPKQGGFDFNWALDTKGDVKQLAAEV
HDPESGRRLQLYTSEPGVQFYTSNFLDGSVKGKAGKTYLHWSGFTLETQHFPDAPNQPTF
ASTRLNPGQTYTQSTVFKFSAN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgatacctgctctcgggcctggccatgtccttgctgatcgccagtggc
ggcgcccaggccgcagggctcaccagcgaacacaaaccgtttggtaaaaccaacgacggc
accgccgtcgaacagtacatcttgcgcaacagccacggcatgcaagccacggtgatcacc
tacggcggcgtgctgcagtcgctgaaagtgccggataaaaacggcaaggtcgacgacgtg
gtactcggcttcgacgacgtgcagggctaccaggctggcaccgcgtttttcggtgcgacc
atcgggcgtttcggcaatcgcctcgcgggcggtgcctttgagctcgacggcaagcgctac
caggtgccactcaacgacggccccaactcgctgcacggcggcgcacaaggcttcgacaag
cacgtttggaaggcctcgcccgtcaaatccaaggactcggtcggcgtcaccctcacctac
ctgtccaaggacggtgaaatgggcttccccggcaacctgaaaaccgaagtcacctatcgc
ctcaacgataaaaacgaactgcacatcgactacaaggccaccaccgacaaacccacagtg
ctcaacctcaccaaccacagctacttcaacctcgccggcgcggggaatggcgacattctc
aagcaggtcgccaccttgcatgccagccattacaccccggtgaatgccaccttgattccg
accggcgaactggcccccgtcaagggcacgccgatggacttcctcaaaccgacgccgatc
ggccagcacatcaaggaggatcatccgcagctcaaatttgccgagccgaaacaaggcggg
tttgacttcaactgggcgctggacaccaaaggcgacgtcaagcaattggccgccgaggtg
catgatcctgagtcaggtcggcgcttgcagctgtacaccagcgagccaggggtgcagttc
tataccagtaacttcctcgacggttcggtgaagggcaaggctgggaagacctacctgcac
tggagtggtttcaccttggagacccagcactttccggatgcgcctaaccaaccgacattt
gcctccacccgcctgaacccagggcaaacctacacccagagcaccgtcttcaaattctcc
gcaaactaa

DBGET integrated database retrieval system