KEGG   Pseudomonas fluorescens SBW25: PFLU2671Help
Entry
PFLU2671          CDS       T00899                                 

Definition
putative magnesium chelatase protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pfs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2949517..2950515
Genome map
AA seq 332 aa AA seqDB search
MTDIPHFPLSAVVGADDLKLALCLTAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALGEGRAQFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGTNLIERDGISHRHSARFVLIGTMNPEEGELRPQLLDRFGFNVALSGQTLPTERGQ
IIRRRLDFDSDPAVFCVQWSEPQAALRERCTQARARLDSIELDDRALAQITERCFAAGVD
GLRADLVWLRGARAHAAWRGANAIAEEDIEAVAEFALRHRRQEQAPPSSPPPEGQAPKPS
DTSPGQGQWGDMPAPALPTGARRDVPAWPKKP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgactgatattccccatttcccgctgtccgccgtggtcggcgccgacgacctgaaactg
gcgctgtgcctgaccgccatcgacccaaagatcggcggcgtgctgatcgaaggcccacgc
ggcatggccaagtcgaccctggcgcgcggcctcgcggacctgttggccagcggacagttc
gtgaccttgccgttgggcgccaccgaagagcgcctggtgggcacactggacctggacgcc
gcattgggcgagggccgtgcgcaattttcacccggcgtattggccaaggctgacggcggc
gtgttgtatgtcgacgaggtcaacttgctacccgatcacctggtggacctgctgttggac
gtggcggcaagcggcaccaacctgatcgagcgcgacggcatttcccatcgccattcggcg
cggtttgtgctgatcggcaccatgaacccggaggagggcgagctgcgcccgcaactgctc
gaccgctttggtttcaacgtggcgttgagcgggcagaccttgccgaccgagcgcgggcag
atcatccgtcggcggttggatttcgacagcgatcccgcggtgttctgcgtgcaatggtct
gagcctcaagcagccttgcgcgaacgttgtacccaggcgcgggcgcggctcgacagtatc
gagttggatgaccgggcgctggcgcagatcaccgagcggtgcttcgccgccggtgtcgac
ggcctgcgtgcggaccttgtctggctgcgaggcgccagggcgcatgccgcatggcggggg
gccaacgccatcgccgaggaagatatcgaagccgttgccgagtttgccctgcgccatcgc
cgtcaggagcaagcgccaccgtccagcccgcctcctgaaggccaggcaccgaaaccgtcg
gacacctcgcccggccaaggccaatggggtgatatgcccgccccggcgttacccaccggc
gctcgtcgggatgtgcccgcctggccaaaaaagccctag

DBGET integrated database retrieval system