KEGG   Pseudomonas fluorescens SBW25: PFLU2763Help
Entry
PFLU2763          CDS       T00899                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFLU2763
Enzymes [BR:pfs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PFLU2763
Exosome [BR:pfs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFLU2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3054282..3056519
Genome map
AA seq 745 aa AA seqDB search
MSFTNKEPLQAKLTALPASKDVEALVRAEHHDPFSILGPHDDEHGGQFIRAFLPEALSVH
VLARDSGEQLGSLDASQVPGLFVGQFKTREPYLLKIQWAGGEQITEDPYSFQQLLLGEMD
LYLFGEGNHRDLSSCLGAQVTSVDGVQGVRFAVWAPNARRVSVVGDFNIWDGRRHPMRLR
HPSGVWEIFIPRLQPGAAYKYEILGANGILPLKADPMALATQLPPDTASKVAEPLQVDWQ
DHAWMQSRVDKQKPTAPLSIYELHVGSWQCELDEAGEVARQYNWRELAERLVPYVQQLGF
THVELMPIMEHPFGGSWGYQALSQFAPTARFGSPEDFAYFVDALHQADIGVILDWVPAHF
PTDTHGLAQFDGTALYEYANPLEGFHQDWDTLIYNLGRTEVHGYMLASALHWLKHFHIDG
LRVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIDFLRHLNDVVALEAPGALVIAEEST
AWPGVSQPTQQGGLGFNYKWNMGWMHDSLHYIQQDPVYRAHHHNELSFGLVYAWSERFIL
PISHDEVVHGKHSLIDKMPGDRWQKFANLRAYLAFMWMHPGKKLLFMGCEFGQWREWNHD
QQLDWYLLQYAEHKGVQKLVGDLNRLYREEPALHEQDDAPQGFQWLIGDDAINSVYAWLR
WSKDGKPVLVVANFTPVPREGYKVGVPFAGRWSEVINSDADMYAGSNYGNGGEVFTQDEP
NHGQAVSLALNLPPLGVLILRPEPL
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagctttacaaataaagaaccgctgcaagcgaagttgactgcattgccggcgtccaag
gacgtcgaagcgctggtacgcgccgagcatcacgacccgttttcgattctcgggccgcac
gatgatgagcacggtggccagtttatccgcgctttcctgccggaggccttaagtgtccac
gtgctggcacgcgacagcggtgaacagctcggcagcctggacgcgagccaggtgccgggg
ttgttcgtcggccagttcaagacccgcgaaccctatttgttgaaaatccagtgggccggc
ggtgagcagatcactgaagacccttacagcttccagcaactgttgctgggggaaatggac
ctgtacctgttcggcgaaggcaaccatcgtgacctcagcagttgcctgggtgcccaggtg
accagcgtcgatggcgtgcagggtgtgcgctttgccgtgtgggcgccgaatgcgcggcgg
gtgtcggtggtgggcgacttcaatatctgggacggccgccgtcacccgatgcgcctgcgt
catccgtccggcgtgtgggagatctttatcccacgcctgcaaccgggcgcggcctacaag
tacgaaattcttggcgccaatgggatcctgccgctcaaggccgaccccatggcattggcc
acccagttgccgccggacaccgcctcgaaggtggccgaaccgttgcaagtggactggcag
gaccacgcctggatgcagtcgcgggtcgacaagcaaaagcccacggcgccgctgtcgatc
tacgagctgcatgtgggctcctggcaatgcgagttggatgaagcgggcgaagtggcccgc
cagtacaactggcgtgagctggctgagcgcttggttccctatgtgcagcaactgggcttc
acccacgtcgagctgatgccgatcatggagcacccgtttggcggctcttggggctaccag
gcactgtcgcaattcgccccgacggcgcggttcggctcgccggaagatttcgcctatttc
gtcgatgccctgcaccaggccgacatcggtgtgatcctggactgggtgccggcgcatttt
cccaccgatacccacggcctcgcgcaattcgacggcaccgcgttgtacgaatacgccaac
ccgctggaaggctttcaccaggattgggacacgctgatctacaacctgggtcgcaccgaa
gtgcacggctacatgctcgcttcggcgctgcattggctcaagcacttccatatcgacggg
ctgcgtgtggatgccgtcgcgtcgatgctctaccgcgactactcgcgcaaggccggcgaa
tgggtgccgaaccgtcatggcggtcgcgagaacctggaggcgattgattttctgcgccac
ttgaacgacgtggtggccctggaagcgcccggcgcgctggtgatcgccgaggaatccacg
gcctggccaggtgtcagccagccgacccaacagggcggcctgggcttcaactacaagtgg
aacatgggctggatgcacgattccctgcactacatccagcaggacccggtgtaccgcgcc
catcaccacaacgagttgagcttcggcctggtgtatgcgtggtccgagcgctttatcctg
ccgatttcccacgatgaagtggtgcacggcaagcactcgctgatcgacaagatgcccggc
gaccgctggcagaaatttgccaacctgcgcgcttacctggcgttcatgtggatgcacccc
ggtaagaaactgctgttcatgggctgcgaattcggccagtggcgcgagtggaaccacgac
cagcaactggactggtacctgttgcagtacgccgaacacaaaggcgtgcaaaagctggtc
ggcgacttgaaccggctgtaccgcgaagaaccggccttgcatgagcaggacgacgcgccg
cagggcttccaatggctgatcggcgacgacgcaatcaacagcgtctatgcctggctgcgc
tggagcaaggacggtaagccggtgctggtggtcgccaacttcaccccggtgccgcgtgag
ggttacaaggtcggcgtgccctttgcggggcgttggagcgaagtgatcaacagtgacgcc
gacatgtacgcaggttccaattacggtaacggaggcgaggtgtttacccaagatgaaccg
aaccatgggcaagcggtgtcactggcgttgaatctgccgccattgggggtactgattctg
cggccggaaccgctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system