KEGG   Pseudomonas fluorescens SBW25: PFLU2985Help
Entry
PFLU2985          CDS       T00899                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PFLU2985
   00052 Galactose metabolism
    PFLU2985
   00500 Starch and sucrose metabolism
    PFLU2985
   00520 Amino sugar and nucleotide sugar metabolism
    PFLU2985
Enzymes [BR:pfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PFLU2985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3252521..3253360
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTQMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLTQMVKLYQKYRCTIVAVMEVNPTETNKYGVIAGDDIGD
GLIRVRDMVEKPAPEDAPSNLAIIGRYILTPDIFKLIEETEPGKGGEIQITDALLKQAKD
GCVIAYKFKGQRFDCGGAEGYIEATNFCYEHFYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccagcagccggttacggcactcgcttcttgccagcgacc
aaggccatgcccaaagagatgctgccggtggtgaacaagccactgattcagtacggcgtc
gaagaggcactggatgccggcctgaacgaaatctccatcgtgaccggtcgtggtaagcgc
gcactggaagaccactttgacatcagctacgagctggaaaaccagatcaagggcaccgac
aaggaaaaatacctggtcggtatccgcaaactgctcgacgagtgctcgttctcctacacc
cgtcagactcagatgaaaggccttggccacgccatcctcaccggccgtccactgatcggc
gacgagccgttcgccgtggtactggcggacgacctgtgtgtgaacctggaaggcgatggt
gtgctgacccagatggtcaagctctaccagaaataccgttgcaccatcgttgcagtgatg
gaagtgaacccgaccgaaaccaacaagtacggcgttatcgccggtgacgacattggcgat
ggcctgatccgcgtacgtgacatggttgaaaaaccagcaccggaagacgcgccttcgaac
ctggcgatcatcggtcgttacatcctgaccccggatatcttcaaactgatcgaagaaacc
gagccaggcaaaggcggcgagatccagatcaccgacgccctgctcaagcaagccaaagac
ggctgcgtgattgcctacaagttcaagggccagcgtttcgactgcggcggcgctgaaggc
tacatcgaagcgaccaacttctgctacgagcacttctacaagactggcaaggcttactga

DBGET integrated database retrieval system