KEGG   Pseudomonas fluorescens SBW25: PFLU3213Help
Entry
PFLU3213          CDS       T00899                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFLU3213
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFLU3213
   00620 Pyruvate metabolism
    PFLU3213
   00640 Propanoate metabolism
    PFLU3213
  Energy metabolism
   00680 Methane metabolism
    PFLU3213
Enzymes [BR:pfs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PFLU3213
Lipid biosynthesis proteins [BR:pfs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PFLU3213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3517346..3519028
Genome map
AA seq 560 aa AA seqDB search
MGTGQIPTIIIRYVMRDYDSAVSTFDYLQLAAQDLHGEPEALNACIECCDRHAHGNAVAL
YCETRDGRATRYTFSELQVHAARFANFLRAQGVQPGDRVAGLLPRTVELVITVLGTWRIG
AVYQPLFTAFGPKAIEQRLACSGARWIVTDSHNRPKLDDIPDCPRVIVADGPPQHPNDDG
FWDALGRQHADCTPELLDASAPFLLMCTSGTTGPAKPLEVPLSAILAFKSYMRDSIDLRE
DDHFWNLADPGWAYGLYYAVTGPLACGRATLFHDGPFTVESTCRIIAKYAISNLAGSPTA
YRLLIAAGAEFADAVRGQLRIVSSAGEPLNPQVIRWFAEQLGVVIHDHYGQTEIGMVLCN
HHGLRHPVREGSAGYAVPGYRIVVLDDAYQELPTGQPGVLAVDRERSPLCWFNGYLHMPT
KAFVDRYYLSGDIVELNADGSISFVGRNDDVITTSGYRVGPFDVESALIEHPAVVEAAVI
GKPDPQRTELIKAFVVLNRQYLPSAELAEVLRLHVKQRLAAHAYPREIEFVEQLPKTPSG
KVQRFILRNQEIAKQQALDT
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacagggcaaattccaacaataataatcaggtacgttatgcgcgattacgactca
gcggtgtcaacgttcgactatctacaactggcggctcaagacttgcacggcgaaccggaa
gccttgaacgcctgcatcgagtgctgcgaccggcacgctcatggcaatgccgtggcgttg
tactgcgaaacgcgggatggccgcgccacgcgctatacgttcagcgaattgcaggtgcac
gctgcgcgcttcgcaaacttcctgcgagcgcaaggggtacagccgggagatcgtgtcgcc
ggactgctgccacgcacagttgaactggtgattactgtcctcgggacctggcgcatcggc
gcggtctaccaaccgctctttaccgcattcgggcccaaggcgatcgagcagcgattggcg
tgctccggggcacgctggatcgtgaccgattcccacaatcgtcccaagctggatgacatc
cccgactgccctcgcgtcattgtggccgacggccccccacagcacccgaacgatgacggt
ttctgggacgccctcggccgtcaacacgccgactgcacgcctgagctgctggacgccagt
gcgcctttcctgctcatgtgtacctcgggcactacaggacctgccaagccgcttgaggtg
cctttgagcgccattctggccttcaaaagttatatgcgcgattcaatcgacctgcgcgaa
gacgaccatttctggaacctcgccgaccccggctgggcctatggcttgtattacgcagtc
accgggccactggcgtgcggccgggccacgctgttccatgacgggcctttcaccgtggaa
agcacctgccggattatcgccaagtatgcgatcagcaacctggccggctcgcccacggcc
tatcgcctgctgattgctgccggggccgagttcgccgacgccgtgcgtggtcaactgcgt
atcgtcagcagcgccggcgaaccgctcaacccgcaagtcatccgttggttcgccgaacag
ctcggcgtggtcattcacgaccattacggccagaccgaaatcggcatggtgctgtgcaat
caccatgggctacgccatccggtacgtgagggttctgccggttacgcggtgccggggtac
cggattgtcgtgctggatgatgcgtatcaggaattaccgacgggtcagccgggcgtactg
gcggtggaccgcgagcgctcgcccctgtgctggttcaatggctacttgcatatgcccacc
aaggcttttgtcgaccgttactacttgagcggcgatatcgtggagctcaatgcggacggc
agtatcagctttgtaggccgtaacgacgatgtgatcaccacatccggctaccgcgtgggg
cctttcgatgtcgagagtgcgctgatcgaacatccggcagtcgtcgaagccgcggtgatc
ggcaagcccgacccgcaacgcaccgagttgatcaaggcgtttgtggtgctgaaccgtcag
tacctgcccagtgcggagttggcggaagtcttgcgcctgcatgtcaaacagcgcttggct
gcgcatgcgtacccccgggaaatcgagttcgtcgaacaactgcccaagaccccgagtggc
aaggtgcagcggttcattctgcgcaaccaggaaattgccaaacagcaggcactcgacaca
tga

DBGET integrated database retrieval system