KEGG   Pseudomonas fluorescens SBW25: PFLU3261Help
Entry
PFLU3261          CDS       T00899                                 

Definition
putative arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFLU3261
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PFLU3261
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PFLU3261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3611412..3612326
Genome map
AA seq 304 aa AA seqDB search
MSDANGKTLRLLFPQWQGGNNPPYHFGAQLLSWLAPEHLGPVEEVPVNLPDGSTLTPEGG
IIGRSALLRQLYAARALIDKHQPDRLVVLGGDCLVDLAPFAYLNERYDADLAILWVDAHP
DILTPNDFQHAHAMVLGNLLGEGDPDFLKAVKRPIKPANVMYAGLQATMDVETAMIARLG
LSSASAGELAYSSEPVLQWLKSTGAKHLAIHFDLDVLDPTLFRSLLFANPDVPASTWDGI
AQGKMTMAQVVRLLGDVANVIDVVGIGIAEHLPWDALALKNMLTKLPLIGQPETKLSVSP
AHRS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgccaacggcaagaccctgcgtttgctgtttccacaatggcaaggtggcaac
aacccgccctatcacttcggcgcccagcttctgtcctggctggcgcctgaacacctcggc
ccggtcgaagaggttcctgtgaatctccctgacggctcaacacttacgccggaaggcggg
atcatcggccgaagcgcgttgctgcgccagttgtacgctgcgcgtgcgctgatcgacaag
catcaaccggatcgccttgttgttctgggcggcgactgcctggtggacctggcgccgttt
gcctacctgaacgagcgttatgacgcagacctggccattctctgggtggatgctcacccg
gacatcctgacgccgaacgactttcagcacgcccacgcgatggtgctgggcaacctgcta
ggcgaaggagaccctgatttcctgaaagccgtgaagcgtccaatcaaacccgccaatgtg
atgtacgcaggcctgcaagcaacgatggacgttgaaaccgcaatgatcgccaggctgggc
ctgtcgagtgcaagtgctggcgaactggcgtattccagcgagcccgtcttgcaatggctg
aaatcgacaggagcgaagcatctggcgatccacttcgacttggacgtgctggacccgacg
ctgtttcgttcattactgttcgccaaccctgacgttcctgccagcacatgggacggcatc
gctcagggaaaaatgaccatggcgcaggttgttcgcctcctcggggatgtggcaaacgtc
atcgatgtggtcggaatcggtattgccgaacacctgccgtgggacgcgttggcactaaaa
aacatgctgaccaaactgccgctgattggccagccagaaacgaaacttagcgtttcaccg
gcgcatcgaagctga

DBGET integrated database retrieval system