KEGG   Pseudomonas fluorescens SBW25: PFLU3366Help
Entry
PFLU3366          CDS       T00899                                 

Definition
putative glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFLU3366
Enzymes [BR:pfs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PFLU3366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3723979..3726063
Genome map
AA seq 694 aa AA seqDB search
MSEANLEILASRAGLAVDWIDANGRPQRVTPDALRAVLKGLGHPADSDAEIDASLLELER
VQQDKHLPPLLTIDSGDGLDLARYFEPDTLCRVSLEDGDTLELRLDGNAVLPGVIALGYH
QVHIADQVFTLAVAPTHCYSVAEAVDTQPARAWGLSAQLYGLRRLGDGGFGDTLALEHLA
RSAAERGADALAISPMHAMFSADTGRYSPYSPSSRLFLNSLYASPGCILGEREVRNAIES
LGLADELHALEQHTLIDWPAAAKAKQRLLRALYKDFRHGHHPQHADFLSFRQAGGEALEN
HCRFEAVQAARAAAGEALDWRQWPEDWRSPQSPALAQFAEDNRDEIGYFAFSQWLIARCL
ERAQQAARGSGMGVGLIADLAVGADGGGSQAWSRQDELLADLTVGAPPDILNRAGQGWGI
SAFSPEGLKRNGFRAFIEMLRANFAHAGGLRIDHVMGLQRLWVIPMDASPREGAYLYYPV
DDLLRLLALESHRHQAIVLGEDLGTVPDGLREKLIARSILGMRVLLFEQNHEGRFTPILD
WPDNALATTSTHDLPTLNGWWHSRDIDWNIQLGLIDAPTVEQWSEHRLRERQALRQALSQ
DPQNFVEEIRNETDHMIDASARYLGHTRAPLVLLPLEDALGVEEQANLPGTTDTHPNWRR
RLPGEASSLLDNAGAARRLELLAVARNQAYERDR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaagcgaacctggaaatcctcgccagccgagcgggcctggccgtcgattggatc
gacgcaaacggccgcccgcaacgtgtaacacccgacgccctgcgcgccgttctcaaaggc
ctgggccacccggccgacagtgacgcagagatcgacgccagcctgcttgaactggagcgg
gtacaacaagacaaacacctgccgcccttactgaccatcgacagtggtgacggcctcgac
ctggcgcgctacttcgaaccggacaccctgtgccgggtcagcctggaagacggcgacacc
ctggaactgcggctcgatggcaatgccgtcctgccaggcgtcattgccctgggttatcac
caagtgcatatcgccgatcaggtcttcaccctggccgtcgcccccacgcattgctacagc
gtcgccgaagcggtcgatacccaaccggcccgcgcctggggcctcagcgcgcaactgtat
ggcctgcgccgcctgggcgacggcggttttggcgacaccctggccttggagcacttggcc
cgctcggcggccgagcgcggcgccgatgccctggccatcagcccgatgcatgcgatgttc
agcgccgacaccgggcgctacagcccgtattcgccatcgagccggttgttcctcaacagt
ttgtacgcctccccgggctgcatcctgggtgaacgcgaagtgcgcaacgcgatcgagtcc
ctcggcctggcagatgaactgcacgcgttggagcaacacaccctgatcgactggcccgcc
gctgccaaggccaagcaacgcctgttgcgtgcactctataaagacttccgtcacggccac
cacccacaacacgcagacttcctcagtttccgccaggccggtggcgaggcgctggaaaac
cattgccgcttcgaagccgtgcaagcggctcgcgcagcggcgggtgaagcactcgactgg
cgccaatggcccgaagactggcgcagcccgcagagcccggcattggcgcagttcgccgaa
gacaatcgcgacgagatcggctacttcgcgttcagccaatggctgatcgcccgttgcctt
gagcgcgcgcaacaagctgcgcgcggcagcggcatgggcgtcggcttgatcgccgacctc
gcggtgggcgccgacggcggtggcagccaggcctggagccgccaggatgaattgctggca
gacctgaccgtcggtgcgccgcccgacattctcaaccgtgccggccagggctgggggatt
tccgccttctcgcccgaaggtctcaagcgcaatggctttcgcgcctttatcgaaatgctg
cgcgccaacttcgcccacgccggcggcttgcgcatcgaccatgtgatgggcctgcaacgc
ctgtgggtgatccccatggacgcctcgccgcgcgaaggcgcctacctgtattacccggtg
gatgacctgttgcggctgttggcgctggagtcccaccgtcaccaggccattgtgctcggt
gaagacttgggcacggtgccggatggcctgcgtgaaaaactcatcgcgcgctcgatcctg
ggcatgcgtgtgttgctgttcgagcaaaaccacgagggccggttcacgccgatcctcgac
tggccggacaacgccctggccaccaccagcacccatgatttaccgaccctgaacggttgg
tggcacagccgcgatatcgactggaacatccagctcggcctgatcgacgcgcccacggtg
gagcaatggagtgaacaccgcctgcgcgaacgccaggcactgcgccaggccttgagccag
gacccgcagaacttcgtcgaagaaatccgcaatgaaaccgaccatatgatcgacgccagt
gcgcgctacctcggccacacccgcgcgcccctggtgctgttgccgttggaggacgccctc
ggggtggaggaacaagccaacctgcccggcaccaccgacacccatcccaattggcgtcgc
cgcctgccgggcgaggcgtccagcctgctcgacaatgccggtgccgcccgccgcctcgag
ctgttggccgtcgcgcgcaaccaagcctatgagcgtgaccgatga

DBGET integrated database retrieval system