KEGG   Pseudomonas fluorescens SBW25: PFLU3723Help
Entry
PFLU3723          CDS       T00899                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pfs00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4120155..4121630)
Genome map
AA seq 491 aa AA seqDB search
MTNNTPLILAIDEGTSNAKAVLVNERGQVIARGSRPLSITHPQPGFSEQDPLLIWYSTLA
AIEECLAQVDRPITALAISNQRESVVAWDRHTGEVLSPCISWQCRRSTALCAQLHEQGHE
ALILDKTGLALDPMFSAGKFRWILDHLEDGHARAAAGDICLGTVDSWLLWKLSGGQVFAT
DYSNAARTQLFNLHTCAWDPVLLDLFQIPLAALAPIQPSAGFFAETVAAGGLPAGIPVMS
MIGDSNAALYGQGGFAPGLVKATLGTGSSLMTPMGGPIASTHGLSTTLAWHDGGQPTFGM
EGNIVHTGAAVQWASRLVAGESLDVLTEQAAQLPDNGGVYFVPALSGLGAPHWQADARGL
ICGLTEVTSGAHILRASLESIGYQIRDVFEAMQQDIGSPLKELWVDGGATRNRWLMQFLA
NLLQRPVVRSLSPEVSALGAAHLAGRALGVWVSDEALGALERQRERFEPQDDCAMAGRYS
AWKKTLARTLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacgaataacactccgctgatcctggcgatagatgaaggcaccagcaacgccaaggcg
gtgctggtcaacgaacgcgggcaggtgattgcgcggggctcgcggccgctgagcatcacc
catccgcagccggggttttccgagcaggacccgctgctgatctggtacagcaccctggcc
gccatcgaagaatgcctggcccaagtggaccggccgatcaccgcgctggcgatcagcaac
cagcgtgaatcggtggtggcctgggaccggcataccggcgaagtactgtcgccgtgcatc
agttggcaatgccgacgctccaccgcgttgtgtgcccagttgcatgagcaggggcatgag
gcactgattctggacaaaaccggcttggcgttggacccgatgttctcggcaggcaagttc
cgctggattctcgaccaccttgaggatggccacgcacgcgccgccgccggcgatatctgc
ctgggcacggtggacagctggctgctgtggaagctcagcggcggtcaggtgttcgccacc
gactactccaacgcggcgcgcactcaactgttcaacctgcacacctgtgcctgggacccg
gtgctgttggacctgttccagattccactggccgcattggcgcccatccagccgagcgcc
ggcttttttgcggaaaccgtcgcggcgggtggtttgcccgccggcatcccggtgatgtcg
atgatcggtgactccaacgctgcgctgtacgggcagggcggttttgcgccggggctggtg
aaagcgacactcggcaccggctcgtcgttgatgacgcccatgggcggcccgattgcctcg
acgcacgggctgtccaccaccctggcctggcatgacggcggccaaccgacgttcggtatg
gaaggcaacatcgtccacaccggcgccgccgtgcagtgggcttcgcgcctggtggcgggg
gaatccctggatgtgctcaccgagcaggccgcgcaactacccgacaacggtggcgtgtat
tttgtgccggcgctgtccgggctgggcgcgccacactggcaggcggatgcacgtggcttg
atctgcgggctgaccgaggtcacttccggcgcgcatatcctgcgggcgtcgctggagtcg
attgggtatcagatccgggatgtcttcgaggccatgcagcaggacatcggcagcccgttg
aaggagctgtgggtggacggcggcgcgacgcgcaaccgttggttgatgcagtttttggct
aacctgttgcaacgcccggtggtgcgcagcctgtcgccggaggtctcggcgctgggcgcg
gcgcacctggcggggagggcgttgggggtgtgggtgagtgatgaagcgctgggcgcgctg
gagcggcagcgggagcggtttgagccgcaggatgattgcgcgatggcggggcgttattca
gcgtggaaaaagacgctggctcggacactgttgtga

DBGET integrated database retrieval system