KEGG   Pseudomonas fluorescens SBW25: PFLU3817Help
Entry
PFLU3817          CDS       T00899                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFLU3817
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PFLU3817
Enzymes [BR:pfs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PFLU3817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4211859..4213184
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRAYSAADVVRLRGSVQPEHTFAKLGAEKLWKLVT
QGAKPSFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKGPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGTPTIILAR
TDANAADLLTSDCDPYDQPFVTGERTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggctgaaaaccca
cgctggaaaggcgtgacccgcgcttattccgctgctgacgtcgtccgcctgcgtggctcg
gttcaacctgagcacacctttgcaaaactcggcgccgaaaaactgtggaagctggtcacc
cagggtgccaagccgtccttccgccccgagaaagatttcgtcaactgcatgggcgccctc
actggcggccaggcagtccaacaggtaaaagccggtatccaggcgatctacctgtccggc
tggcaagtggcagcggacaacaactccgctgaatccatgtaccccgaccaatcgctgtac
ccggtggactcggtgccgaccgtggtcaagcgcatcaacaactcgttccgccgcgccgac
cagatccagtggaaagccggtaaaggcccgggcgatgaaggctacatcgactacttcgcg
ccgatcgtggcggacgctgaagccggtttcggcggcgtactgaacgcctacgaactgatg
aagagcatgatcgaggccggcgctgccggcgtgcacttcgaagaccaactggcgtcggtg
aagaaatgcggccacatgggcggcaaggtattggttccgacccaggaagctgtacagaag
ctgaccgctgcccgcctggccgctgacgttgccggcacaccgaccatcatcctggcccgt
accgatgctaacgccgctgacctgctgacctcggactgcgacccgtacgaccagccgttc
gtaacgggcgaacgcacccaggaaggcttctataaagtgcgcgccggtctcgaccaggcc
atcgcccgcggcctggcctatgcgccgtacgccgacctgatctggtgcgaaaccgccaaa
ccggacctggacgaagcccgtcgcttcgccgaagcgatcaaaaaggaatacccggaccaa
ctgctgtcctacaactgctcgccttccttcaactggaagaagaacctggacgacgcaacc
atcgccaagttccagcgcgaactgtcagccatgggctacaagcatcagttcatcaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaagagttcgctgacgccgccaagggttac
accttcgtggcgcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggcggcacctcgtccgtgaccgcgctgaccggttcgaccgaagaagagcagttc
cactaa

DBGET integrated database retrieval system