KEGG   Pseudomonas fluorescens SBW25: PFLU4115Help
Entry
PFLU4115          CDS       T00899                                 

Definition
putative alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PFLU4115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFLU4115
  Lipid metabolism
   00071 Fatty acid degradation
    PFLU4115
  Amino acid metabolism
   00350 Tyrosine metabolism
    PFLU4115
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PFLU4115
   00626 Naphthalene degradation
    PFLU4115
Enzymes [BR:pfs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PFLU4115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4552997..4554046
Genome map
AA seq 349 aa AA seqDB search
MTFMKAVVYEAFSQPPRLMNVEDPTPERHGVVVQVRGTGVCRSDWHGWKGHDPDIQLPHV
PGHELAGIVTEVGRDITRWKVGDRVTVPFVGGCGACPECNSGNQQVCTTQFQPGFTHWGS
FAEYVGIHQADLNLVALPESMDFATAASLGCRFATSFRAVVDQGNVSAGQWVAVHGCGGV
GLSAVMIAQALGANVIAIDISPEKLELARALGAVATVNAHSVADVTEAVLDITQGGAHVS
LDALGHPTTCFNSINNLRRRGKHVQVGLMLADHATPAIPMSKVIAHELEIYGSHGMQAHR
YDAMIQMITSGKLAPEKLVGKTISLEQSIDALMNMDRFETAGVTVVTEF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgactttcatgaaagcagttgtctatgaagccttttcccaaccgccgcgcctgatgaac
gtcgaagacccgacgccggagcgtcacggtgtggtcgtacaggtgcggggcacgggcgtc
tgccgcagcgactggcacggttggaaggggcatgatccggacatccaactgccgcatgtt
cccgggcatgagcttgccggcatcgtgacggaggttggcagggacatcacccggtggaag
gtcggcgaccgtgtaacggtgccctttgtcggcggatgtggcgcgtgtcccgagtgcaac
agcggtaaccagcaagtctgcactacgcagtttcaaccgggcttcactcattgggggtcg
tttgcggagtacgtcggtatacaccaggccgacttgaacctcgtcgcgcttccggagagc
atggactttgctaccgctgcgagcctgggctgccgcttcgcgacttcatttcgcgccgtc
gttgaccaaggcaacgtcagcgccggacagtgggtggcggtgcatggctgcggaggcgtg
ggcctgtccgccgtgatgatcgcccaggccctcggcgcgaatgtcatcgccatcgatatt
tcgccggaaaaactcgaactggctcgcgcgctcggcgccgttgcaaccgtgaacgcacac
agcgttgcggacgtcaccgaagccgtgctggacatcacccaggggggcgcccacgtatcg
ctggatgcattgggccatcccaccacgtgcttcaactccatcaacaacctgcgccgtcga
ggcaagcacgtccaggtgggcctgatgctcgccgaccacgccacgccggcgatccccatg
agcaaggtcatcgcgcacgagcttgagatctatggcagccatggcatgcaagcacatcgt
tatgacgccatgatccagatgatcacctccggaaaactggcgccggaaaaactcgtgggt
aaaaccatcagcctggagcagtccatcgacgcgttgatgaacatggatcgcttcgagacc
gccggcgtaaccgtcgtgaccgagttctag

DBGET integrated database retrieval system