KEGG   Pseudomonas fluorescens SBW25: PFLU4145Help
Entry
PFLU4145          CDS       T00899                                 

Gene name
rplT
Definition
50S ribosomal protein L20
Orthology
K02887  
large subunit ribosomal protein L20
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    PFLU4145 (rplT)
Ribosome [BR:pfs03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    PFLU4145 (rplT)
  Bacteria
    PFLU4145 (rplT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4588544..4588900)
Genome map
AA seq 118 aa AA seqDB search
MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL
WIARINAGARVNGLSYSRFIAGLKKASIEIDRKVLAELAVNEKAVFAAIVEKAKATLA
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgtaaagcgtggcgtcattgcccgtaaacgtcacaaaaaaattctgaaactt
gctaaaggctactacggcgcgcgttcacgcgtattccgtgttgccaagcaagcggtaatc
aaggcaggccaatacgcctaccgcgaccgtcgtcagaaaaaacgtcagttccgcgctctg
tggatcgctcgtatcaacgccggtgcacgtgttaacggtctgtcctacagccgtttcatc
gctggcctgaaaaaagcgtccatcgaaatcgaccgtaaggttctggctgaactggccgtg
aacgaaaaagcggtgtttgctgcgattgtcgagaaagctaaagccaccttggcttaa

DBGET integrated database retrieval system