KEGG   Pseudomonas fluorescens SBW25: PFLU4156Help
Entry
PFLU4156          CDS       T00899                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PFLU4156
Enzymes [BR:pfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PFLU4156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4595563..4596480)
Genome map
AA seq 305 aa AA seqDB search
MPAKVVVVGSLNMDLVTRASRLPRAGETLIGQTFSTVPGGKGANQAVASARLGADVSMIG
CVGTDAYGTQLRDALQVEGIDCQAVSTVDGSSGVALIVVDDSSQNAIVIVAGSNGELTPA
SLQAFDAVLQAADVIVCQLEVPMKTVGYALKRGRELGKTVILNPAPASAPLPAEWYASID
YLIPNESEATALSGVTVDSIDSAKAAATHLIQAGAGKVIITLGAQGALFTDGQGFEHLLA
PKVKAVDTTAAGDTFVGGFAAALANGKSEAEAIRFGQVAAALSVTRAGAQPSIPTLHDVQ
GFVPS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagtagtggtagtaggcagcttgaacatggacctggtgacccgtgccagt
cggttgccgcgtgccggtgagaccttgatcggccagacgttctccaccgtgcccggcggc
aagggcgcgaaccaggcggtagcgtcggcacgcctgggggccgatgtgtcgatgattggc
tgtgtgggtaccgatgcctatggcacgcaattgcgtgatgcgttgcaggtggagggcatc
gattgccaagccgtcagtaccgtagacggctccagtggcgtggccctcatcgtggtcgat
gacagcagccagaatgcgattgtgatcgtggcgggcagtaacggcgaactgacgccagcc
tcgttgcaggcgttcgatgcggtgctgcaagcggctgacgtgatcgtctgccagctggaa
gtgccgatgaagacggtgggttacgccctcaagcgcggtcgtgaactgggcaagacggtg
atccttaacccggctccggccagcgctccgttgccggctgaatggtatgcctcgatcgac
tacctgatcccgaatgaaagcgaagccaccgcactgagcggcgtgacggtcgactccatt
gacagcgccaaggcagccgcaacccacctgatccaggcgggcgccggcaaagtcatcatc
accctgggggctcagggcgcgctgtttactgacggccagggctttgagcacctgctggcg
ccgaaggtcaaggcggtcgacaccaccgcagcgggcgataccttcgtcggtggctttgct
gcggcactcgccaatggcaaaagcgaggccgaggccattcgttttggccaggtcgctgcg
gcactgtcggtcacccgcgccggcgcgcaaccctctattccaacgctgcacgacgtacaa
ggttttgtgccctcatga

DBGET integrated database retrieval system