KEGG   Pseudomonas fluorescens SBW25: PFLU4336Help
Entry
PFLU4336          CDS       T00899                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PFLU4336
Enzymes [BR:pfs01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PFLU4336
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PFLU4336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4783898..4784428)
Genome map
AA seq 176 aa AA seqDB search
MSYVAVYSAASPDTPNKVLTHFDDIAATLAEHGVRFERWQPSPIGQGASDAEMIAAYQMH
IDALGYEAIEVVRVTGDHPQKAELRAQFLDERCYSEDEVRFFIAGQGLFSLHIGDYVYAV
RCEKNDLLVIPAGIKHWFDMGENPHCVALRCFNTAQGLVPLLTGDTIARHFPGLDD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgtcgctgtttactccgccgcttcaccggacacgccgaacaaggtcctgacc
cattttgacgatatcgccgcgaccctggcggagcacggcgtgcgctttgaacgctggcag
ccgagcccgatagggcagggggccagtgacgctgaaatgattgcggcgtaccagatgcac
attgatgcccttggctacgaggctattgaggtggtacgcgtgaccggcgatcacccgcag
aaggctgaactgcgtgcgcagtttcttgacgagcgctgctacagcgaagatgaggtgcgt
tttttcatcgcggggcagggtttgttttccctgcacattggcgactacgtgtacgccgtg
cgctgtgagaaaaatgacctgttggtgatcccggccggtatcaagcactggttcgatatg
ggcgagaacccgcattgtgttgccttgcggtgtttcaataccgcacaagggctggtgccc
ctattgacgggcgacactatcgcccggcacttccctggcttggacgactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system