KEGG   Pseudomonas fluorescens SBW25: PFLU4336Help
Entry
PFLU4336          CDS       T00899                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pfs00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4783898..4784428)
Genome map
AA seq 176 aa AA seqDB search
MSYVAVYSAASPDTPNKVLTHFDDIAATLAEHGVRFERWQPSPIGQGASDAEMIAAYQMH
IDALGYEAIEVVRVTGDHPQKAELRAQFLDERCYSEDEVRFFIAGQGLFSLHIGDYVYAV
RCEKNDLLVIPAGIKHWFDMGENPHCVALRCFNTAQGLVPLLTGDTIARHFPGLDD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgtcgctgtttactccgccgcttcaccggacacgccgaacaaggtcctgacc
cattttgacgatatcgccgcgaccctggcggagcacggcgtgcgctttgaacgctggcag
ccgagcccgatagggcagggggccagtgacgctgaaatgattgcggcgtaccagatgcac
attgatgcccttggctacgaggctattgaggtggtacgcgtgaccggcgatcacccgcag
aaggctgaactgcgtgcgcagtttcttgacgagcgctgctacagcgaagatgaggtgcgt
tttttcatcgcggggcagggtttgttttccctgcacattggcgactacgtgtacgccgtg
cgctgtgagaaaaatgacctgttggtgatcccggccggtatcaagcactggttcgatatg
ggcgagaacccgcattgtgttgccttgcggtgtttcaataccgcacaagggctggtgccc
ctattgacgggcgacactatcgcccggcacttccctggcttggacgactaa

DBGET integrated database retrieval system