KEGG   Pseudomonas fluorescens SBW25: PFLU4413Help
Entry
PFLU4413          CDS       T00899                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PFLU4413
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PFLU4413
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PFLU4413
Two-component system [BR:pfs02022]
 CheA family
  CheA-CheYBV
   PFLU4413
Bacterial motility proteins [BR:pfs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PFLU4413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4877029..4878168)
Genome map
AA seq 379 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQAIALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQ
MLCEKVHSISRSNRRSLFSAPTPTPTPAPAAAPSAPAPSFGRPAPAPAPVARPAVAPARA
SASSAHSPAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFA
ERLDKLCRITVKEAEDGDILRPGLALLAPGGKQMMVDGRGAIKILPGDERLNYKPCVDIT
FGSAAKSYGDKVLAVVLTGMGADGREGARLLKQGGSAIWAQDEASCVIYGMPMAIVKADL
ADAVYSLDDIGKHLVEACL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtggtggacgattcgggtttcttccgccgtcgcgtctcggaa
attctttccgccgatccaacgatccaggtggtcggcacggccaccaacggcaaagaagcg
attgatcaagccattgcgttgaagccggacgtgatcaccatggactacgagatgccgatg
atggatggcatcacggcagttcgccatatcatgcaacgctgcccgaccccggtgttgatg
ttctcctcgctgacccacgaaggcgcccgagtgaccctcgacgcgttggacgctggcgcg
gtggatttcctgccgaagaatttcgaagacatctcgcgcaaccccgagaaggtcaagcag
atgctgtgcgagaaggtgcacagcatttcgcgcagtaaccgacgcagcctgttcagcgcg
ccgacgccgacgccgacgcctgcaccggccgcggccccgtctgcgcctgcgccttcgttt
ggtcgacctgctcctgcgcctgcgccggttgctcggcctgccgtggcgcctgcccgtgca
tcggcctccagcgctcactccccggcgcccaagcgcaaggcctacaagctggtcgccatc
ggtacatccaccggcggcccggtcgccctgcagcgcgtgttgactcaactgccggccaac
tttccggcgccgattgtgctgatccagcacatgcccgccgccttcaccaaagccttcgcc
gaacgcctggacaagctgtgccgcatcaccgtcaaggaagcggaggatggtgacatcctg
cgccctggcctggcgttgctggccccaggtggcaagcaaatgatggtggacgggcgtggc
gcgatcaaaatcctgccgggcgatgagcgcctgaactacaagccgtgcgtggatatcacc
ttcggttcggcagccaagtcctacggcgacaaagttctggcggtggtgctcaccggcatg
ggcgccgacggccgtgaaggcgcgcgcctgctcaagcagggcggcagcgccatctgggcg
caggacgaagccagctgcgtgatctatggcatgcccatggccatcgtcaaagcggacctg
gccgacgcggtctacagcctggacgatatcggcaagcatctggtggaggcttgcctctga

DBGET integrated database retrieval system