KEGG   Pseudomonas fluorescens SBW25: PFLU4478Help
Entry
PFLU4478          CDS       T00899                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pfs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pfs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4946625..4947176)
Genome map
AA seq 183 aa AA seqDB search
MQMRWLAVPVLMAIGSVASAASCPPLLEGQLPKLRAKESIDLCQRFAGKPLVIVNTASFC
GFAPQFKGLEALYQRYKGEGLEVIGVPSDDFKQEAKTGEETAKVCYVNYGVTFTMTEPQR
VKGPDAVHLFKVLAQQTDAPPKWNFYKYVVDRQGKVIANFSSLTKPDSPELIKAVEEAIA
SKP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcgctggctcgctgtacccgtcctgatggcaatcggcagtgtcgcctctgct
gccagttgcccgccgctgctggaaggccaattgcccaagctgcgcgccaaggaatccatc
gacctgtgccaacgttttgccggcaaacccttggtcatcgtcaataccgcgagcttctgc
gggttcgccccacagttcaaagggctcgaagcgttgtatcaacgctacaagggcgaaggg
ctggaagtgatcggcgtgccgtccgatgacttcaagcaggaagccaagaccggtgaagag
accgccaaggtgtgttacgtgaattatggcgtgacctttaccatgaccgagccacaaagg
gtcaaggggccggacgcggtgcatttgttcaaggtattggcgcagcagaccgacgcgccg
ccgaagtggaatttctacaagtatgtggtggatcggcagggcaaggtgattgccaatttc
tccagccttaccaagccggacagtccggagctgatcaaggcggtggaggaggcgatcgcc
tccaaaccgtga

DBGET integrated database retrieval system