KEGG   Pseudomonas fluorescens SBW25: PFLU4914Help
Entry
PFLU4914          CDS       T00899                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pfs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5393558..5394169)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGLGYELEVPMTTLYRLPSVGEPITLHTHLVVREDAQLL
YGFIGKRDRDFFRELIRLNGVGPKLALALMSSLEVDELVRAVSAQDTSALTKVPGVGKKT
AERLLVELKDRFKAWEVVPSMFALVPNQPDMPAGQVASAESDAVSALISLGYKPQEASKA
VSAIKDKNLSSEDMIRRALKGMI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtttgcgcggcaccctggctgagaaacagccgccgcacctgattctggat
gtgaacgggctggggtatgagctggaagtgcccatgaccaccctgtatcgcctaccgtcg
gtcggtgagccgataacgctgcacacgcatctagtggtgcgcgaagatgcgcaactcctc
tatggtttcattggcaagcgcgaccgcgacttcttccgcgagctgatccgcctcaatggc
gtgggcccgaaattggcgctggcgttgatgtcgagcctggaagtcgatgagctggttcgt
gccgtttcggcccaggacacctcggcgctgaccaaggtgccgggcgtcggcaagaagacc
gccgagcgcctgctggtggagctcaaggaccgtttcaaggcatgggaagttgtaccaagc
atgtttgccctggtgccgaatcagccagatatgccggcgggccaagtggccagtgccgaa
agcgatgcggtcagcgcgctgatatccctgggctacaagccacaggaagccagcaaggcc
gtgtcggccatcaaggacaagaacctgagcagtgaagacatgatccgccgcgccctgaag
ggaatgatttaa

DBGET integrated database retrieval system