KEGG   Pseudomonas fluorescens SBW25: PFLU4914Help
Entry
PFLU4914          CDS       T00899                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PFLU4914 (ruvA)
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PFLU4914 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5393558..5394169)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGLGYELEVPMTTLYRLPSVGEPITLHTHLVVREDAQLL
YGFIGKRDRDFFRELIRLNGVGPKLALALMSSLEVDELVRAVSAQDTSALTKVPGVGKKT
AERLLVELKDRFKAWEVVPSMFALVPNQPDMPAGQVASAESDAVSALISLGYKPQEASKA
VSAIKDKNLSSEDMIRRALKGMI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtttgcgcggcaccctggctgagaaacagccgccgcacctgattctggat
gtgaacgggctggggtatgagctggaagtgcccatgaccaccctgtatcgcctaccgtcg
gtcggtgagccgataacgctgcacacgcatctagtggtgcgcgaagatgcgcaactcctc
tatggtttcattggcaagcgcgaccgcgacttcttccgcgagctgatccgcctcaatggc
gtgggcccgaaattggcgctggcgttgatgtcgagcctggaagtcgatgagctggttcgt
gccgtttcggcccaggacacctcggcgctgaccaaggtgccgggcgtcggcaagaagacc
gccgagcgcctgctggtggagctcaaggaccgtttcaaggcatgggaagttgtaccaagc
atgtttgccctggtgccgaatcagccagatatgccggcgggccaagtggccagtgccgaa
agcgatgcggtcagcgcgctgatatccctgggctacaagccacaggaagccagcaaggcc
gtgtcggccatcaaggacaagaacctgagcagtgaagacatgatccgccgcgccctgaag
ggaatgatttaa

DBGET integrated database retrieval system