KEGG   Pseudomonas fluorescens SBW25: PFLU5005Help
Entry
PFLU5005          CDS       T00899                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFLU5005 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFLU5005 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PFLU5005 (thrC)
Enzymes [BR:pfs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PFLU5005 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5499132..5500541)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLATDGGLYVPENLPRFTQEEIALWAGLPYHELAFRVMR
PFVTGSIPDADFKKILEETYGVFSHSAIAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLEKRGERVVIIGATSGDTGSAAIEGCKHCENVDIFILHPHKRVSEVQRRQMTTI
FGENIHNIAIEGNFDDCQEMVKNSFADQSFLKGTRLVAVNSINWARIMAQIVYYFHASLQ
LGGPARSVSFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDMHGRNGAAIAGLMDTFKSGGGFSVDEERWTETRKLFDS
LAVDDAQTCETIAEVYAQTGELLDPHTAIGVKAARECRRSLDIPMVILGTAHPVKFPEAV
EKAGVGKALELPVHLANLFEREERCTVLANDLKAVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatatcagcacccgcggccaggcaccggccctgaatttcgaagatgtcttgctg
gcaggccttgccactgacggcggcctgtatgtgccggaaaacctgccacgcttcacccag
gaagaaatcgctttgtgggccggcctgccgtaccacgagctggccttccgggtgatgcgc
ccgttcgtcaccggcagcattcccgatgcggactttaaaaagattctggaagagacctac
ggcgtgttttcccacagcgccatcgcgcctctgcgccagctgaatggcaacgagtgggtg
cttgaactgttccacggcccgaccctggcgttcaaggacttcgccctgcaactgctcggt
cgtttgctggattatgtgctggagaagcgcggtgagcgcgtggtgatcattggcgccacc
tccggtgacactggttcggccgccatcgaaggctgcaagcactgcgaaaacgtcgacatc
ttcatcttgcacccgcacaagcgcgtgtcggaagtgcagcgtcgccagatgaccaccatt
tttggcgagaacatccacaacatcgccatcgaaggcaacttcgatgactgccaggaaatg
gtcaagaacagcttcgccgaccagagcttcctgaaaggcacgcgcctggtggcggtgaac
tcgatcaactgggcgcggatcatggcccagatcgtctattacttccatgcctccctgcag
ttgggcgggccggcgcgttcggtgtcgttctcggtgccaaccggcaacttcggcgacatc
ttcgccggttacctggcgcgcaacatgggcctgccgatcaaccagttgatcgtcgccacc
aaccgcaatgacatcctgcaccgcttcatgagcggcaaccagtacgtcaaggaaaccctg
cacgcgaccctgtcgccgtcgatggacatcatggtttcttcgaacttcgagcgcctgctg
ttcgacatgcacggtcgcaatggcgcggcgattgccggcttgatggacaccttcaagagc
ggtggcggtttcagcgttgacgaagagcgctggacagaaacccgcaagctgttcgactcg
ctggccgtggacgacgcacagacctgcgaaaccatcgctgaagtctacgcccagaccggc
gagctgctcgacccgcacaccgccatcggtgtgaaggccgcgcgcgaatgccgtcgcagc
ctggacatcccgatggtgatactcggcaccgcgcacccggtgaaattcccggaagcggtg
gagaaggccggggttggcaaggcactggaattgccggtgcacctggcaaacctgttcgag
cgtgaagagcgttgcaccgtattggccaatgacctgaaggctgtgcaggcgtttgtgagc
cagcacggcaaccggggtaagccgctgtaa

DBGET integrated database retrieval system